Property Summary

NCBI Gene PubMed Count 19
PubMed Score 22.45
PubTator Score 5.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count
Liver carcinoma 217

Expression

Synonym

Accession Q969F0
Symbols CT43
FATE

Gene

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Mouse EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid

Gene RIF (3)

PMID Text
26567849 FATE1 is a key survival factor in multiple oncogenic backgrounds. FATE1 prevents the accumulation of the stress-sensing BH3-only protein, BCL-2-Interacting Killer (BIK), thereby permitting viability in the presence of toxic stimuli.
18976975 Knockdown of fetal and adult testis expressed 1 (FATE1) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
12811541 This study has shown that only 1.4% of infertile men have mutations in the FATE gene, and that some of these mutations do not singly cause infertility.

AA Sequence

MAGGPPNTKAEMEMSLAEELNHGRQGENQEHLVIAEMMELGSRSRGASQKKQKLEQKAAGSASAKRVWNM      1 - 70
TATRPKKMGSQLPKPRMLRESGHGDAHLQEYAGNFQGIRFHYDRNPGTDAVAQTSLEEFNVLEMEVMRRQ     71 - 140
LYAVNRRLRALEEQGATWRHRETLIIAVLVSASIANLWLWMNQ                               141 - 183
//

Text Mined References (19)

PMID Year Title
26567849 2015 Comprehensive functional characterization of cancer-testis antigens defines obligate participation in multiple hallmarks of cancer.
25416956 2014 A proteome-scale map of the human interactome network.
22458338 2012 Host-pathogen interactome mapping for HTLV-1 and -2 retroviruses.
21516116 2011 Next-generation sequencing to generate interactome datasets.
17761949 2007 Increased steroidogenic factor-1 dosage triggers adrenocortical cell proliferation and cancer.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16381901 2006 The LIFEdb database in 2006.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15580283 2005 Immunohistochemical analysis of the expression of FATE/BJ-HCC-2 antigen in normal and malignant tissues.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
More...