Property Summary

NCBI Gene PubMed Count 23
PubMed Score 22.45
PubTator Score 5.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma, Hepatocellular 228 0.0 0.0
Disease Target Count
Liver carcinoma 240

Expression

Gene RIF (4)

AA Sequence

MAGGPPNTKAEMEMSLAEELNHGRQGENQEHLVIAEMMELGSRSRGASQKKQKLEQKAAGSASAKRVWNM      1 - 70
TATRPKKMGSQLPKPRMLRESGHGDAHLQEYAGNFQGIRFHYDRNPGTDAVAQTSLEEFNVLEMEVMRRQ     71 - 140
LYAVNRRLRALEEQGATWRHRETLIIAVLVSASIANLWLWMNQ                               141 - 183
//

Text Mined References (23)

PMID Year Title