Property Summary

NCBI Gene PubMed Count 19
PubMed Score 22.45
PubTator Score 5.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Liver carcinoma 217

Expression

Gene RIF (3)

PMID Text
26567849 FATE1 is a key survival factor in multiple oncogenic backgrounds. FATE1 prevents the accumulation of the stress-sensing BH3-only protein, BCL-2-Interacting Killer (BIK), thereby permitting viability in the presence of toxic stimuli.
18976975 Knockdown of fetal and adult testis expressed 1 (FATE1) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
12811541 This study has shown that only 1.4% of infertile men have mutations in the FATE gene, and that some of these mutations do not singly cause infertility.

AA Sequence

MAGGPPNTKAEMEMSLAEELNHGRQGENQEHLVIAEMMELGSRSRGASQKKQKLEQKAAGSASAKRVWNM      1 - 70
TATRPKKMGSQLPKPRMLRESGHGDAHLQEYAGNFQGIRFHYDRNPGTDAVAQTSLEEFNVLEMEVMRRQ     71 - 140
LYAVNRRLRALEEQGATWRHRETLIIAVLVSASIANLWLWMNQ                               141 - 183
//

Text Mined References (19)

PMID Year Title
26567849 2015 Comprehensive functional characterization of cancer-testis antigens defines obligate participation in multiple hallmarks of cancer.
25416956 2014 A proteome-scale map of the human interactome network.
22458338 2012 Host-pathogen interactome mapping for HTLV-1 and -2 retroviruses.
21516116 2011 Next-generation sequencing to generate interactome datasets.
17761949 2007 Increased steroidogenic factor-1 dosage triggers adrenocortical cell proliferation and cancer.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16381901 2006 The LIFEdb database in 2006.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15580283 2005 Immunohistochemical analysis of the expression of FATE/BJ-HCC-2 antigen in normal and malignant tissues.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
More...