Property Summary

NCBI Gene PubMed Count 10
PubMed Score 13.38
PubTator Score 5.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
adult high grade glioma -1.100 2.0e-04
medulloblastoma, large-cell -1.100 5.0e-05
osteosarcoma -1.029 9.9e-04
psoriasis -2.700 2.2e-05

Gene RIF (2)

AA Sequence

MAGAAEDARALFRAGVCAALEAWPALQIAVENGFGGVHSQEKAKWLGGAVEDYFMRNADLELDEVEDFLG      1 - 70
ELLTNEFDTVVEDGSLPQVSQQLQTMFHHFQRGDGAALREMASCITQRKCKVTATALKTARETDEDEDDV     71 - 140
DSVEEMEVTATNDGAATDGVCPQPEPSDPDAQTIKEEDIVEDGWTIVRRKK                       141 - 191
//

Text Mined References (13)

PMID Year Title