Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
active Crohn's disease 1.221 1.2e-02
adult high grade glioma -1.200 3.6e-04
atypical teratoid / rhabdoid tumor -1.900 3.2e-09
fibroadenoma 1.100 2.8e-02
glioblastoma -1.300 1.1e-03
group 3 medulloblastoma -1.300 2.4e-04
intraductal papillary-mucinous carcinoma... -1.300 3.6e-03
intraductal papillary-mucinous neoplasm ... -2.000 3.1e-02
medulloblastoma, large-cell -2.900 1.4e-06
osteosarcoma 1.019 2.2e-02
ovarian cancer -2.600 1.0e-11
primitive neuroectodermal tumor -1.500 1.2e-03
subependymal giant cell astrocytoma -1.177 4.4e-03

Gene RIF (1)

AA Sequence

MEKPYNKNEGNLENEGKPEDEVEPDDEGKSDEEEKPDVEGKTECEGKREDEGEPGDEGQLEDEGSQEKQG      1 - 70
RSEGEGKPQGEGKPASQAKPESQPRAAEKRPAEDYVPRKAKRKTDRGTDDSPKDSQEDLQERHLSSEEMM     71 - 140
RECGDVSRAQEELRKKQKMGGFHWMQRDVQDPFAPRGQRGVRGVRGGGRGQRGLHDIPYL              141 - 200
//

Text Mined References (9)

PMID Year Title