Property Summary

NCBI Gene PubMed Count 27
Grant Count 96
R01 Count 48
Funding $6,014,441.13
PubMed Score 70.55
PubTator Score 221.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Synonym

Accession Q969E3 Q496H2 Q5SR91
Symbols SCP
SPC
UCNIII

Gene

PDB

2RMH   3N93  

Gene RIF (19)

PMID Text
26350463 results show that activation of CRH receptors by CRH ligands stimulates VEGF-A expression in intestinal epithelial cells through the cAMP/CREB pathway
26076035 The paracrine actions of Ucn3 activate a negative feedback loop that promotes somatostatin release to ensure the timely reduction of insulin secretion upon normalization of plasma glucose.
25304878 The molecular modifications of urocortin 3[36-38] led to an improved understanding of the relationship between molecular structure and biological activity of this peptide, could be further tested for possible clinical treatment of depression
25148370 Data suggest that UCN3 expression can serve as a late stage maturation/differentiation marker in beta-cells during pancreogenesis. [REVIEW]
23349753 SCP inhibits a subpopulation of PVN neurons, especially OTergic magnocellular neurons, by enhancing the activity of GIRK channels via CRF-R2
22000474 study showed that Ucn2 and Ucn3 differentially regulate the LPS-induced TNF-alpha and IL-10 expression and secretion in trophoblast explants acting through CRH-R2. Ucn3 has an anti-inflammatory effect.
21454316 These data suggest a possible involvement of urocortin 2 and Ucn 3 in the mechanisms of endometriosis.
21360527 Confirm the anti-inflammatory function of VIP, through the modulation of the expression of CRF system that impacts in a reduction of mediators with inflammatory/destructive functions.
20616367 Placental Ucn2 and Ucn3 expression is sensitive to O(2) tensions and mediated by HIF-1alpha. In preeclampsia, the increased expression of both peptides may reflect a response to the oxidative stress.
20368512 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MLMPVHFLLLLLLLLGGPRTGLPHKFYKAKPIFSCLNTALSEAEKGQWEDASLLSKRSFHYLRSRDASSG      1 - 70
EEEEGKEKKTFPISGARGGARGTRYRYVSQAQPRGKPRQDTAKSPHRTKFTLSLDVPTNIMNLLFNIAKA     71 - 140
KNLRAQAAANAHLMAQIGRKK                                                     141 - 161
//

Text Mined References (30)

PMID Year Title
26350463 2015 Corticotropin Releasing Hormone and Urocortin 3 Stimulate Vascular Endothelial Growth Factor Expression through the cAMP/CREB Pathway.
26076035 2015 Urocortin3 mediates somatostatin-dependent negative feedback control of insulin secretion.
25304878 2014 Short analogs and mimetics of human urocortin 3 display antidepressant effects in vivo.
25148370 2014 Maturation of stem cell-derived beta-cells guided by the expression of urocortin 3.
23349753 2013 Effects of stresscopin on rat hypothalamic paraventricular nucleus neurons in vitro.
22449649 2012 Genome-wide association study of intelligence: additive effects of novel brain expressed genes.
22000474 2011 Effects of urocortin 2 and urocortin 3 on IL-10 and TNF-? expression and secretion from human trophoblast explants.
21454316 2011 Urocortin 2 and urocortin 3 in endometriosis: evidence for a possible role in inflammatory response.
21360527 2011 Mapping the CRF-urocortins system in human osteoarthritic and rheumatoid synovial fibroblasts: effect of vasoactive intestinal peptide.
20966082 2010 Structural basis for hormone recognition by the Human CRFR2{alpha} G protein-coupled receptor.
More...