Property Summary

NCBI Gene PubMed Count 31
PubMed Score 74.08
PubTator Score 221.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Inflammation 120 0.0 0.0
Lung diseases 50 0.0 0.0
Disease Target Count Z-score Confidence
chronic kidney disease 90 3.539 1.8

Expression

Synonym

Accession Q969E3 Q496H2 Q5SR91
Symbols SCP
SPC
UCNIII

Gene

PDB

2RMH   3N93  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (23)

AA Sequence

MLMPVHFLLLLLLLLGGPRTGLPHKFYKAKPIFSCLNTALSEAEKGQWEDASLLSKRSFHYLRSRDASSG      1 - 70
EEEEGKEKKTFPISGARGGARGTRYRYVSQAQPRGKPRQDTAKSPHRTKFTLSLDVPTNIMNLLFNIAKA     71 - 140
KNLRAQAAANAHLMAQIGRKK                                                     141 - 161
//

Text Mined References (34)

PMID Year Title