Property Summary

NCBI Gene PubMed Count 7
PubMed Score 29.84
PubTator Score 15.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
urothelial carcinoma -2.600 0.026
osteosarcoma -1.165 0.002
primitive neuroectodermal tumor 1.100 0.012
intraductal papillary-mucinous neoplasm ... 1.200 0.043
interstitial cystitis -4.500 0.000
group 3 medulloblastoma 1.300 0.026
ulcerative colitis -1.700 0.000

Gene RIF (5)

PMID Text
20845358 LEAP-2 has a novel fold for a cationic antimicrobial peptide and has antibacterial activity. LEAP-2 exhibits antimicrobial activity under low-salt conditions, and there is likely to be another physiological role for the peptide.
20845358 LEAP-2 displays antimicrobial activity against bacteria and yeasts.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20038463 Data suggest that LEAP-2 is not involved in the physiological response of GI epithelia to iron, nor is it mitogenic for epithelial cells or chemotactic for THP-1 monocytes.
19852990 These results show that the secondary structure of human LEAP-2 has a profound impact on its antibacterial activity.

AA Sequence

MWHLKLCAVLMIFLLLLGQIDGSPIPEVSSAKRRPRRMTPFWRGVSLRPIGASCRDDSECITRLCRKRRC      1 - 70
SLSVAQE                                                                    71 - 77
//

Text Mined References (7)

PMID Year Title
20845358 2010 Structural and functional analysis of human liver-expressed antimicrobial peptide 2.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20038463 2010 Expression and functional analyses of liver expressed antimicrobial peptide-2 (LEAP-2) variant forms in human tissues.
19852990 2010 Structure-activity relationship of human liver-expressed antimicrobial peptide 2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12493837 2003 Isolation and biochemical characterization of LEAP-2, a novel blood peptide expressed in the liver.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.