Property Summary

NCBI Gene PubMed Count 8
PubMed Score 32.71
PubTator Score 15.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
group 3 medulloblastoma 1.300 2.6e-02
interstitial cystitis -4.100 1.5e-04
intraductal papillary-mucinous neoplasm ... 1.200 4.3e-02
osteosarcoma -1.165 1.5e-03
primitive neuroectodermal tumor 1.100 1.2e-02
ulcerative colitis -1.700 2.3e-05
urothelial carcinoma -2.600 2.6e-02

Gene RIF (6)

AA Sequence

MWHLKLCAVLMIFLLLLGQIDGSPIPEVSSAKRRPRRMTPFWRGVSLRPIGASCRDDSECITRLCRKRRC      1 - 70
SLSVAQE                                                                    71 - 77
//

Text Mined References (8)

PMID Year Title