Property Summary

NCBI Gene PubMed Count 7
PubMed Score 29.84
PubTator Score 15.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
interstitial cystitis 2299 7.56078975745265E-7
ulcerative colitis 2087 2.33142895595212E-5
osteosarcoma 7933 0.00152286797308993
primitive neuroectodermal tumor 3031 0.0123981413803534
group 3 medulloblastoma 2254 0.0260547731808063
urothelial carcinoma 318 0.0264172211929789
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0426321960841835
Disease Target Count Z-score Confidence
Pellagra 25 4.826 2.4
Coccidiosis 4 4.296 2.1

Expression

  Differential Expression (7)

Disease log2 FC p
urothelial carcinoma -2.600 0.026
osteosarcoma -1.165 0.002
primitive neuroectodermal tumor 1.100 0.012
intraductal papillary-mucinous neoplasm ... 1.200 0.043
interstitial cystitis -4.500 0.000
group 3 medulloblastoma 1.300 0.026
ulcerative colitis -1.700 0.000

Synonym

Accession Q969E1 D3DQ91 LEAP-2
Symbols LEAP-2

Gene

PDB

2L1Q  

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Xenopus EggNOG Inparanoid

Gene RIF (5)

PMID Text
20845358 LEAP-2 has a novel fold for a cationic antimicrobial peptide and has antibacterial activity. LEAP-2 exhibits antimicrobial activity under low-salt conditions, and there is likely to be another physiological role for the peptide.
20845358 LEAP-2 displays antimicrobial activity against bacteria and yeasts.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20038463 Data suggest that LEAP-2 is not involved in the physiological response of GI epithelia to iron, nor is it mitogenic for epithelial cells or chemotactic for THP-1 monocytes.
19852990 These results show that the secondary structure of human LEAP-2 has a profound impact on its antibacterial activity.

AA Sequence

MWHLKLCAVLMIFLLLLGQIDGSPIPEVSSAKRRPRRMTPFWRGVSLRPIGASCRDDSECITRLCRKRRC      1 - 70
SLSVAQE                                                                    71 - 77
//

Text Mined References (7)

PMID Year Title
20845358 2010 Structural and functional analysis of human liver-expressed antimicrobial peptide 2.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20038463 2010 Expression and functional analyses of liver expressed antimicrobial peptide-2 (LEAP-2) variant forms in human tissues.
19852990 2010 Structure-activity relationship of human liver-expressed antimicrobial peptide 2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12493837 2003 Isolation and biochemical characterization of LEAP-2, a novel blood peptide expressed in the liver.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.