Property Summary

NCBI Gene PubMed Count 231
PubMed Score 713.05
PubTator Score 308.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Breast cancer -2.300 1.5e-60
cystic fibrosis -1.500 9.8e-04
ductal carcinoma in situ -2.300 4.2e-05
intraductal papillary-mucinous carcinoma... -1.200 4.3e-02
invasive ductal carcinoma -2.600 1.4e-04

Gene RIF (210)

AA Sequence

MFPFALLYVLSVSFRKIFILQLVGLVLTYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCS      1 - 70
NRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQ     71 - 140
VSQLQGLWRRFNRPLLKQQ                                                       141 - 159
//

Text Mined References (233)

PMID Year Title