Property Summary

NCBI Gene PubMed Count 204
Grant Count 307
R01 Count 146
Funding $58,362,217.18
PubMed Score 624.16
PubTator Score 308.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
intraductal papillary-mucinous carcinoma... -1.200 0.043
cystic fibrosis -1.600 0.002
Breast cancer -2.300 0.000
ductal carcinoma in situ -2.300 0.000
invasive ductal carcinoma -2.600 0.000

Synonym

Accession Q969D9 G3XAM8 Q8IW99 Q96AU7
Symbols

Gene

Gene RIF (184)

PMID Text
26992000 study shows that specific food antigens can trigger innate immune mediated esophageal TSLP secretion
26879860 Epidermal thymic stromal lymphopoietin predicts the development of atopic dermatitis during infancy.
26712523 The association of TSLP polymorphism rs2289278 with atopic dermatitis (AD) was stronger in children with allergic sensitization than in children without atopy, and TSLP polymorphisms also increased the risk of asthma in children with AD
26652578 Upon TSLP stimulation, the cells with the highest TSLPR expression level showed enhanced proliferation and JAK/STAT-mediated gene regulation in a dose-dependent manner
26573878 production by monocyte-derived dendritic cells requires the integration of signals from dectin-1, the IL-1 receptor, and endoplasmic reticulum stress response stress signaling pathways
26531761 TSLP expression in the skin is mediated via RARgamma-RXR pathways.
26531692 This study indicated that the elevation of microRNA-19b suppressed TSLP expression and then influenced T cell development in thymomatous Myasthenia gravis
26419317 Heat stress-induced HSPs can significantly reduce the production and secretion of TSLP from keratinocytes cultured under Th2 environment.
26288354 CD4+ T cells from atopic dermatitis patients directly interacted with TSLP to produce a higher amount of IL-4 than those from normal subjects, and this action was attenuated with anti-TSLPR antibody
26175262 Correlation between TSLP overexpression and gastric cancer metastasis to lymph nodes indicate that TSLP plays a role in lymph node involvement in gastric cancer patients.
More...

AA Sequence

MFPFALLYVLSVSFRKIFILQLVGLVLTYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCS      1 - 70
NRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQ     71 - 140
VSQLQGLWRRFNRPLLKQQ                                                       141 - 159
//

Text Mined References (207)

PMID Year Title
26992000 2016 Preferential Secretion of Thymic Stromal Lymphopoietin (TSLP) by Terminally Differentiated Esophageal Epithelial Cells: Relevance to Eosinophilic Esophagitis (EoE).
26879860 2016 Epidermal thymic stromal lymphopoietin predicts the development of atopic dermatitis during infancy.
26712523 2016 TSLP polymorphisms, allergen exposures, and the risk of atopic disorders in children.
26652578 2016 Blockade of thymic stromal lymphopoietin (TSLP) receptor inhibits TSLP-driven proliferation and signalling in lymphoblasts from a subset of B-precursor ALL patients.
26573878 2016 TSLP production by dendritic cells is modulated by IL-1? and components of the endoplasmic reticulum stress response.
26531761 2016 TSLP expression in the skin is mediated via RAR?-RXR pathways.
26531692 2015 Aberrant decrease of microRNA19b regulates TSLP expression and contributes to Th17 cells development in myasthenia gravis related thymomas.
26419317 2016 Heat-shock pretreatment reduces expression and release of TSLP from keratinocytes under Th2 environment.
26288354 2015 TSLP Directly Interacts with Skin-Homing Th2 Cells Highly Expressing its Receptor to Enhance IL-4 Production in Atopic Dermatitis.
26175262 2015 Evaluation of thymic stromal lymphopoietin (TSLP) and its correlation with lymphatic metastasis in human gastric cancer.
More...