Property Summary

NCBI Gene PubMed Count 29
Grant Count 115
R01 Count 64
Funding $25,120,078.45
PubMed Score 1.13
PubTator Score 138.10

Knowledge Summary

Patent

No data available

Expression

Gene

MR1

PDB

4GUP   4L4T   4L4V   4LCW   4NQC   4NQD   4NQE   4PJ5   4PJ7   4PJ8   4PJ9   4PJA   4PJB   4PJC   4PJD   4PJE   4PJF   4PJG   4PJH   4PJI   4PJX   5D5M   5D7I   5D7J   5D7L  

Gene RIF (22)

PMID Text
27043408 Data show that the major histocompatibility complex, class I-related protein (MR1) antigen presentation is characterized by a rapid 'off-on-off' mechanism that is strictly dependent on antigen availability.
27031111 endosome-mediated trafficking of MR1 allows for selective sampling of the intracellular environment
26823810 results suggest that high expression of MR-1 is involved in hepatocellular carcinoma progression
26388332 Studies indicate that the antigen-presenting molecules CD1 and MHC class I-related protein (MR1) display lipids and small molecules to T cells.
25752900 Data indicate that high expression of CD26 ia a specific markers to define major histocompatibility complex, class I-like sequence protein MR1-restricted mucosa-associated invariant T (MAIT) cells.
25049333 Mucosal-associated invariant T cell adaptation was a direct consequence of exposure to various exogenous MR1-restricted epitopes.
24556396 [review] Mucosal-associated invariant T-cell (MAIT) T-cell antigen receptor recognizes riboflavin and folic acid metabolites bound by MR1 in a conserved docking mode and thus acts like a pattern recognition receptor.
24101382 MR1 tetramers allow precise phenotypic characterization of human and mouse mucosal-associated invariant T cells.
23457030 A novel MR1B isoform probably plays a physiological role complementary to MR1A with respect to mucosal-associated invariant T cells development and/or function.
23051753 metabolites of vitamin B represent a class of antigen that are presented by MR1 for MAIT-cell immunosurveillance; as many vitamin biosynthetic pathways are unique to bacteria and yeast, data suggest that MAIT cells use these metabolites to detect microbial infection
More...

AA Sequence

MGELMAFLLPLIIVLMVKHSDSRTHSLRYFRLGVSDPIHGVPEFISVGYVDSHPITTYDSVTRQKEPRAP      1 - 70
WMAENLAPDHWERYTQLLRGWQQMFKVELKRLQRHYNHSGSHTYQRMIGCELLEDGSTTGFLQYAYDGQD     71 - 140
FLIFNKDTLSWLAVDNVAHTIKQAWEANQHELLYQKNWLEEECIAWLKRFLEYGKDTLQRTEPPLVRVNR    141 - 210
KETFPGVTALFCKAHGFYPPEIYMTWMKNGEEIVQEIDYGDILPSGDGTYQAWASIELDPQSSNLYSCHV    211 - 280
EHCGVHMVLQVPQESETIPLVMKAVSGSIVLVIVLAGVGVLVWRRRPREQNGAIYLPTPDR             281 - 341
//

Text Mined References (31)

PMID Year Title
27043408 2016 The intracellular pathway for the presentation of vitamin B-related antigens by the antigen-presenting molecule MR1.
27031111 2016 Endosomal MR1 Trafficking Plays a Key Role in Presentation of Mycobacterium tuberculosis Ligands to MAIT Cells.
26823810 2015 High expression of myofibrillogenesis regulator-1 predicts poor prognosis for patients with hepatocellular carcinoma after curative hepatectomy.
26388332 2015 Lipid and small-molecule display by CD1 and MR1.
25752900 2015 High expression of CD26 accurately identifies human bacteria-reactive MR1-restricted MAIT cells.
25416956 2014 A proteome-scale map of the human interactome network.
25049333 2014 MR1-restricted MAIT cells display ligand discrimination and pathogen selectivity through distinct T cell receptor usage.
24556396 2014 MAITs, MR1 and vitamin B metabolites.
24101382 2013 Antigen-loaded MR1 tetramers define T cell receptor heterogeneity in mucosal-associated invariant T cells.
23457030 2013 MR1B, a natural spliced isoform of the MHC-related 1 protein, is expressed as homodimers at the cell surface and activates MAIT cells.
More...