Property Summary

NCBI Gene PubMed Count 39
PubMed Score 404.94
PubTator Score 207.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Alkaptonuria 4 8.419 4.0

Expression

  Differential Expression (21)

Disease log2 FC p
active Crohn's disease 1.066 1.6e-02
active ulcerative colitis 1.261 8.7e-03
ductal carcinoma in situ 1.200 1.6e-02
Endometriosis -1.290 3.7e-02
fibroadenoma 1.700 5.0e-03
gastric cancer 1.100 1.2e-02
head and neck cancer and chronic obstruc... -1.200 1.9e-02
intraductal papillary-mucinous adenoma (... 1.600 9.7e-04
intraductal papillary-mucinous carcinoma... 1.300 3.1e-02
lung adenocarcinoma 1.700 2.6e-07
lung carcinoma 1.400 5.7e-04
nephrosclerosis -1.744 1.5e-02
non-small cell lung cancer -1.100 4.7e-02
osteosarcoma -1.301 1.2e-04
pancreatic cancer 1.400 5.0e-04
pancreatic carcinoma 1.400 5.0e-04
pancreatic ductal adenocarcinoma liver m... -3.182 7.2e-03
psoriasis -3.100 8.3e-30
Rhinitis -1.100 1.2e-02
subependymal giant cell astrocytoma 1.611 4.7e-02
uncontrolled asthma -1.700 3.6e-03

 OMIM Phenotype (1)

Gene RIF (12)

AA Sequence

MAELKYISGFGNECSSEDPRCPGSLPEGQNNPQVCPYNLYAEQLSGSAFTCPRSTNKRSWLYRILPSVSH      1 - 70
KPFESIDEGQVTHNWDEVDPDPNQLRWKPFEIPKASQKKVDFVSGLHTLCGAGDIKSNNGLAIHIFLCNT     71 - 140
SMENRCFYNSDGDFLIVPQKGNLLIYTEFGKMLVQPNEICVIQRGMRFSIDVFEETRGYILEVYGVHFEL    141 - 210
PDLGPIGANGLANPRDFLIPIAWYEDRQVPGGYTVINKYQGKLFAAKQDVSPFNVVAWHGNYTPYKYNLK    211 - 280
NFMVINSVAFDHADPSIFTVLTAKSVRPGVAIADFVIFPPRWGVADKTFRPPYYHRNCMSEFMGLIRGHY    281 - 350
EAKQGGFLPGGGSLHSTMTPHGPDADCFEKASKVKLAPERIADGTMAFMFESSLSLAVTKWGLKASRCLD    351 - 420
ENYHKCWEPLKSHFTPNSRNPAEPN                                                 421 - 445
//

Text Mined References (44)

PMID Year Title