Property Summary

NCBI Gene PubMed Count 46
Grant Count 14
R01 Count 7
Funding $2,903,493.6
PubMed Score 65.80
PubTator Score 55.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
gastric cancer -1.700 0.000
hepatocellular carcinoma -1.300 0.001
pancreatic cancer -1.500 0.000
interstitial lung disease -1.400 0.007
Multiple myeloma 2.506 0.001
urothelial carcinoma -1.200 0.034
psoriasis 1.800 0.000
cutaneous lupus erythematosus 1.100 0.023
osteosarcoma 1.983 0.000
group 4 medulloblastoma 1.900 0.001
astrocytoma -1.100 0.035
Duchenne muscular dystrophy -1.141 0.000
hereditary spastic paraplegia -1.585 0.007
juvenile dermatomyositis -1.141 0.000
limb girdle muscular dystrophy 2A -1.254 0.000
pancreatic ductal adenocarcinoma liver m... -1.940 0.021
lung cancer -2.800 0.000
colon cancer -1.500 0.004
Breast cancer 4.800 0.022
non primary Sjogren syndrome sicca 1.100 0.033
pancreatic carcinoma -1.500 0.000
lung adenocarcinoma 1.843 0.000
breast carcinoma 1.100 0.000
Alzheimer's disease -1.100 0.016
Pick disease -1.300 0.001
progressive supranuclear palsy -1.100 0.021
invasive ductal carcinoma 1.600 0.005
ovarian cancer 1.600 0.002
dermatomyositis -2.400 0.001

Gene RIF (23)

PMID Text
25003523 Data highlight the oncogenic function of PRL-1 in HCC invasion and metastasis.
24968948 Data indicate that protein-tyrosine-phosphatase of regenerating liver 1 (PRL1) gene was expressed much more highly in prostate cancer (PCa) than in nonneoplastic prostate samples.
24961364 We confirmed with our previous findings that PTP4A1-PHF3-EYS variants were significantly associated with alcohol dependence.
24939702 Upregulation of PRL-1 expression is inversely correlated with miR-26a in primary cervical cancer tissues.
23362275 Results suggest that TRP32 maintains the reduced state of PRL and thus regulates the biological function of PRL.
23324950 PTP4A1-PHF3-EYS variants were associated with alcohol dependence.
22484636 upregulation of PRL-1 protein correlates with shortened patient survival in human hepatocellular carcinoma
22413991 Studies indicate that PRL-1 and PRL-2 and PRL-3 are oncogenes and belong to the few phosphatases that lead to the development of cancer.
22096494 Data conclude that the PHF3-PTP4A1 region appears to harbor a causal locus for alcohol dependence, and proteins encoded by PHF3 and/or PTP4A1 might play a functional role in the disorder.
22009749 PRL-1 binding to p115 RhoGAP provides a coordinated mechanism underlying ERK1/2 and RhoA activation
More...

AA Sequence

MARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPF      1 - 70
DDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGA     71 - 140
FNSKQLLYLEKYRPKMRLRFKDSNGHRNNCCIQ                                         141 - 173
//

Text Mined References (50)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25621764 2015 Translation of 5' leaders is pervasive in genes resistant to eIF2 repression.
25003523 2014 Oncogenic function and prognostic significance of protein tyrosine phosphatase PRL-1 in hepatocellular carcinoma.
24968948 2014 Identification of PRL1 as a novel diagnostic and therapeutic target for castration-resistant prostate cancer by the Escherichia coli ampicillin secretion trap (CAST) method.
24961364 Common PTP4A1-PHF3-EYS variants are specific for alcohol dependence.
24939702 2014 MicroRNA-26a inhibits cell proliferation and invasion of cervical cancer cells by targeting protein tyrosine phosphatase type IVA 1.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23362275 2013 Thioredoxin-related protein 32 (TRP32) specifically reduces oxidized phosphatase of regenerating liver (PRL).
23324950 2013 Association of rare PTP4A1-PHF3-EYS variants with alcohol dependence.
22484636 2012 Increased expression of PRL-1 protein correlates with shortened patient survival in human hepatocellular carcinoma.
More...