Property Summary

NCBI Gene PubMed Count 46
PubMed Score 65.80
PubTator Score 55.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
IGA Glomerulonephritis 454
Disease Target Count P-value
breast carcinoma 1614 7.81550529715141E-12
juvenile dermatomyositis 1189 2.12915733755526E-7
lung cancer 4473 3.03028772105103E-6
osteosarcoma 7933 5.29666336383809E-5
psoriasis 6685 7.47778699728688E-5
lung adenocarcinoma 2714 8.23046302860906E-5
limb girdle muscular dystrophy 2A 156 1.11109376675759E-4
Duchenne muscular dystrophy 602 2.68812987803807E-4
gastric cancer 436 2.75440290914144E-4
pancreatic carcinoma 567 3.90716383968326E-4
pancreatic cancer 2300 3.90716383968335E-4
hepatocellular carcinoma 550 6.28251866963898E-4
Pick disease 1893 7.87107052313302E-4
dermatomyositis 967 8.85992504401802E-4
Multiple myeloma 1328 0.00116911311440698
group 4 medulloblastoma 1875 0.00139853421425406
ovarian cancer 8492 0.00217339249374596
colon cancer 1475 0.00350155722641448
invasive ductal carcinoma 2950 0.00472303926653523
hereditary spastic paraplegia 313 0.00714961944895281
interstitial lung disease 292 0.00722576200339528
Alzheimer's disease 644 0.0162363576798966
pancreatic ductal adenocarcinoma liver metastasis 1795 0.020737074332038
progressive supranuclear palsy 674 0.0214263028768062
Breast cancer 3099 0.0215510499526643
cutaneous lupus erythematosus 1056 0.0225782643692056
non primary Sjogren syndrome sicca 840 0.032516561899167
urothelial carcinoma 318 0.0339812908711341
astrocytoma 1493 0.0352388882792486
Disease Target Count Z-score Confidence
Cerebrovascular disease 231 3.091 1.5
Alcohol dependence 107 3.019 1.5

Expression

  Differential Expression (29)

Disease log2 FC p
gastric cancer -1.700 0.000
hepatocellular carcinoma -1.300 0.001
pancreatic cancer -1.500 0.000
interstitial lung disease -1.400 0.007
Multiple myeloma 2.506 0.001
urothelial carcinoma -1.200 0.034
psoriasis 1.800 0.000
cutaneous lupus erythematosus 1.100 0.023
osteosarcoma 1.983 0.000
group 4 medulloblastoma 1.900 0.001
astrocytoma -1.100 0.035
Duchenne muscular dystrophy -1.141 0.000
hereditary spastic paraplegia -1.585 0.007
juvenile dermatomyositis -1.141 0.000
limb girdle muscular dystrophy 2A -1.254 0.000
pancreatic ductal adenocarcinoma liver m... -1.940 0.021
lung cancer -2.800 0.000
colon cancer -1.500 0.004
Breast cancer 4.800 0.022
non primary Sjogren syndrome sicca 1.100 0.033
pancreatic carcinoma -1.500 0.000
lung adenocarcinoma 1.843 0.000
breast carcinoma 1.100 0.000
Alzheimer's disease -1.100 0.016
Pick disease -1.300 0.001
progressive supranuclear palsy -1.100 0.021
invasive ductal carcinoma 1.600 0.005
ovarian cancer 1.600 0.002
dermatomyositis -2.400 0.001

Synonym

Accession Q93096 B2R6C8 O00648 Q49A54
Symbols HH72
PRL1
PRL-1
PTPCAAX1
PTP(CAAX1)

Gene

PDB

1RXD   1XM2  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid

Gene RIF (23)

PMID Text
25003523 Data highlight the oncogenic function of PRL-1 in HCC invasion and metastasis.
24968948 Data indicate that protein-tyrosine-phosphatase of regenerating liver 1 (PRL1) gene was expressed much more highly in prostate cancer (PCa) than in nonneoplastic prostate samples.
24961364 We confirmed with our previous findings that PTP4A1-PHF3-EYS variants were significantly associated with alcohol dependence.
24939702 Upregulation of PRL-1 expression is inversely correlated with miR-26a in primary cervical cancer tissues.
23362275 Results suggest that TRP32 maintains the reduced state of PRL and thus regulates the biological function of PRL.
23324950 PTP4A1-PHF3-EYS variants were associated with alcohol dependence.
22484636 upregulation of PRL-1 protein correlates with shortened patient survival in human hepatocellular carcinoma
22413991 Studies indicate that PRL-1 and PRL-2 and PRL-3 are oncogenes and belong to the few phosphatases that lead to the development of cancer.
22096494 Data conclude that the PHF3-PTP4A1 region appears to harbor a causal locus for alcohol dependence, and proteins encoded by PHF3 and/or PTP4A1 might play a functional role in the disorder.
22009749 PRL-1 binding to p115 RhoGAP provides a coordinated mechanism underlying ERK1/2 and RhoA activation
More...

AA Sequence

MARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPF      1 - 70
DDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGA     71 - 140
FNSKQLLYLEKYRPKMRLRFKDSNGHRNNCCIQ                                         141 - 173
//

Text Mined References (50)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25621764 2015 Translation of 5' leaders is pervasive in genes resistant to eIF2 repression.
25003523 2014 Oncogenic function and prognostic significance of protein tyrosine phosphatase PRL-1 in hepatocellular carcinoma.
24968948 2014 Identification of PRL1 as a novel diagnostic and therapeutic target for castration-resistant prostate cancer by the Escherichia coli ampicillin secretion trap (CAST) method.
24961364 Common PTP4A1-PHF3-EYS variants are specific for alcohol dependence.
24939702 2014 MicroRNA-26a inhibits cell proliferation and invasion of cervical cancer cells by targeting protein tyrosine phosphatase type IVA 1.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23362275 2013 Thioredoxin-related protein 32 (TRP32) specifically reduces oxidized phosphatase of regenerating liver (PRL).
23324950 2013 Association of rare PTP4A1-PHF3-EYS variants with alcohol dependence.
22484636 2012 Increased expression of PRL-1 protein correlates with shortened patient survival in human hepatocellular carcinoma.
More...