Property Summary

Ligand Count 2
NCBI Gene PubMed Count 50
PubMed Score 66.99
PubTator Score 55.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
Alzheimer's disease -1.100 1.6e-02
astrocytoma -1.100 3.5e-02
Breast cancer 4.800 2.2e-02
breast carcinoma 1.100 7.8e-12
colon cancer -1.300 7.6e-05
cutaneous lupus erythematosus 1.100 2.3e-02
dermatomyositis -2.400 8.9e-04
Duchenne muscular dystrophy -1.141 2.7e-04
gastric cancer -1.700 2.8e-04
group 4 medulloblastoma 1.900 1.4e-03
hepatocellular carcinoma -1.300 6.3e-04
hereditary spastic paraplegia -1.585 7.1e-03
interstitial lung disease -1.400 7.2e-03
invasive ductal carcinoma 1.600 4.7e-03
juvenile dermatomyositis -1.139 2.2e-04
limb girdle muscular dystrophy 2A -1.254 1.1e-04
lung adenocarcinoma 1.843 8.2e-05
lung cancer -1.600 5.5e-03
Multiple myeloma 2.506 1.2e-03
non primary Sjogren syndrome sicca 1.100 3.3e-02
osteosarcoma 1.983 5.3e-05
ovarian cancer -1.200 6.1e-05
pancreatic cancer -1.500 3.9e-04
pancreatic carcinoma -1.500 3.9e-04
pancreatic ductal adenocarcinoma liver m... -1.940 2.1e-02
Pick disease -1.300 7.9e-04
progressive supranuclear palsy -1.100 2.1e-02
psoriasis 1.800 7.5e-05
urothelial carcinoma -1.200 3.4e-02

Gene RIF (25)

AA Sequence

MARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPF      1 - 70
DDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGA     71 - 140
FNSKQLLYLEKYRPKMRLRFKDSNGHRNNCCIQ                                         141 - 173
//

Text Mined References (54)

PMID Year Title