Property Summary

Ligand Count 8
NCBI Gene PubMed Count 85
PubMed Score 160.76
PubTator Score 98.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
gastric carcinoma -1.400 1.3e-02
interstitial cystitis -4.900 8.4e-05
nephrosclerosis -1.972 1.1e-02
osteosarcoma 2.281 1.4e-07
ovarian cancer 1.600 7.1e-09
psoriasis 1.200 4.4e-04

Protein-protein Interaction (2)

Gene RIF (64)

AA Sequence

MPPVGGKKAKKGILERLNAGEIVIGDGGFVFALEKRGYVKAGPWTPEAAVEHPEAVRQLHREFLRAGSNV      1 - 70
MQTFTFYASEDKLENRGNYVLEKISGQEVNEAACDIARQVADEGDALVAGGVSQTPSYLSCKSETEVKKV     71 - 140
FLQQLEVFMKKNVDFLIAEYFEHVEEAVWAVETLIASGKPVAATMCIGPEGDLHGVPPGECAVRLVKAGA    141 - 210
SIIGVNCHFDPTISLKTVKLMKEGLEAARLKAHLMSQPLAYHTPDCNKQGFIDLPEFPFGLEPRVATRWD    211 - 280
IQKYAREAYNLGVRYIGGCCGFEPYHIRAIAEELAPERGFLPPASEKHGSWGSGLDMHTKPWVRARARKE    281 - 350
YWENLRIASGRPYNPSMSKPDGWGVTKGTAELMQQKEATTEQQLKELFEKQKFKSQ                  351 - 406
//

Text Mined References (86)

PMID Year Title