Property Summary

NCBI Gene PubMed Count 82
Grant Count 36
R01 Count 24
Funding $3,377,453.83
PubMed Score 151.86
PubTator Score 98.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
nephrosclerosis -1.972 0.011
psoriasis 1.200 0.000
osteosarcoma 2.281 0.000
interstitial cystitis -5.000 0.000
gastric carcinoma -1.400 0.013
ovarian cancer 1.600 0.000

Gene RIF (61)

PMID Text
26213999 The faster evolutionary rate of BHMT2 overall suggests that selective constraints were reduced relative to BHMT.
25846410 Multiple SNPs in BHMT and BHMT2 were identified to be associated with the occurrence of infant obstructive heart defects and interaction effects with maternal use of folic acid supplements.
25144858 Study suggests BHMT holds considerable potential as a blood biomarker for acute liver injury.
24895213 Data suggest BHMT is activated by binding of potassium ions; role of potassium ions in BHMT appears to be structural; potassium ions facilitate specific binding of substrate homocysteine (rather than substrate betaine) to active site of the enzyme.
23645037 Women harboring the single nucleotide polymorphism BHMT 742G>A have a decreased risk of a Down Syndrome pregnancy.
22339736 Our study suggests that the polymorphism BHMT G742A may modulate the Down syndrome risk in Brazilian mothers.
22339686 Known common single-nucleotide polymorphisms in MTRR and BHMT genes may not be significant risk factors for cororonary artery disease.
22138536 A transcription variant of exon 4 of betaine-homocysteine methyltransferase (BHMT) produces a loss of function of BHMT in human hepatocarcinoma
21630102 The BHMT 742GA or AA genotypes associated with tobacco consumption (P = 0.016) increase the risk for head and neck squamous cell carcinoma.
21565678 This suggests that polymorphism rs3797546 in the BHMT gene may confer genetic risk of NSCL/P in a recessive manner.
More...

AA Sequence

MPPVGGKKAKKGILERLNAGEIVIGDGGFVFALEKRGYVKAGPWTPEAAVEHPEAVRQLHREFLRAGSNV      1 - 70
MQTFTFYASEDKLENRGNYVLEKISGQEVNEAACDIARQVADEGDALVAGGVSQTPSYLSCKSETEVKKV     71 - 140
FLQQLEVFMKKNVDFLIAEYFEHVEEAVWAVETLIASGKPVAATMCIGPEGDLHGVPPGECAVRLVKAGA    141 - 210
SIIGVNCHFDPTISLKTVKLMKEGLEAARLKAHLMSQPLAYHTPDCNKQGFIDLPEFPFGLEPRVATRWD    211 - 280
IQKYAREAYNLGVRYIGGCCGFEPYHIRAIAEELAPERGFLPPASEKHGSWGSGLDMHTKPWVRARARKE    281 - 350
YWENLRIASGRPYNPSMSKPDGWGVTKGTAELMQQKEATTEQQLKELFEKQKFKSQ                  351 - 406
//

Text Mined References (83)

PMID Year Title
26213999 2015 Evolutionary Analyses and Natural Selection of Betaine-Homocysteine S-Methyltransferase (BHMT) and BHMT2 Genes.
25846410 2015 Obstructive heart defects associated with candidate genes, maternal obesity, and folic acid supplementation.
25343990 2015 Genome-wide association study of selenium concentrations.
25144858 2014 Betaine homocysteine methyltransferase (BHMT) as a specific and sensitive blood marker for acute liver injury.
24895213 2014 Specific potassium ion interactions facilitate homocysteine binding to betaine-homocysteine S-methyltransferase.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23720494 2013 Genome-wide association study identifies loci affecting blood copper, selenium and zinc.
23645037 2013 Betaine-homocysteine methyltransferase 742G>A polymorphism and risk of down syndrome offspring in a Brazilian population.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
More...