Property Summary

NCBI Gene PubMed Count 24
PubMed Score 35.57
PubTator Score 32.58

Knowledge Summary

Patent (7,101)

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma -1.400 2.3e-03
Astrocytoma, Pilocytic -1.500 5.5e-08
atypical teratoid / rhabdoid tumor -1.500 5.3e-07
Chronic Lymphocytic Leukemia -2.229 2.0e-07
cutaneous lupus erythematosus 2.600 6.1e-03
ependymoma -1.600 2.9e-03
glioblastoma -1.200 9.5e-05
group 3 medulloblastoma -1.900 6.0e-06
interstitial cystitis 2.900 1.3e-03
lung cancer 1.600 2.5e-03
nasopharyngeal carcinoma -1.300 2.4e-03
oligodendroglioma -1.500 2.9e-03
osteosarcoma -4.705 1.3e-09
primary Sjogren syndrome 1.900 4.3e-04
psoriasis 1.100 6.4e-08
ulcerative colitis 1.700 3.9e-03

 IMPC Phenotype (1)

Gene RIF (13)

AA Sequence

MGQAGCKGLCLSLFDYKTEKYVIAKNKKVGLLYRLLQASILAYLVVWVFLIKKGYQDVDTSLQSAVITKV      1 - 70
KGVAFTNTSDLGQRIWDVADYVIPAQGENVFFVVTNLIVTPNQRQNVCAENEGIPDGACSKDSDCHAGEA     71 - 140
VTAGNGVKTGRCLRRENLARGTCEIFAWCPLETSSRPEEPFLKEAEDFTIFIKNHIRFPKFNFSKSNVMD    141 - 210
VKDRSFLKSCHFGPKNHYCPIFRLGSVIRWAGSDFQDIALEGGVIGINIEWNCDLDKAASECHPHYSFSR    211 - 280
LDNKLSKSVSSGYNFRFARYYRDAAGVEFRTLMKAYGIRFDVMVNGKGAFFCDLVLIYLIKKREFYRDKK    281 - 350
YEEVRGLEDSSQEAEDEASGLGLSEQLTSGPGLLGMPEQQELQEPPEAKRGSSSQKGNGSVCPQLLEPHR    351 - 420
ST                                                                        421 - 422
//

Text Mined References (26)

PMID Year Title