Property Summary

NCBI Gene PubMed Count 24
Grant Count 6
R01 Count 4
Funding $305,423.75
PubMed Score 34.92
PubTator Score 32.58

Knowledge Summary

Patent (7,101)

Expression

  Differential Expression (16)

Disease log2 FC p
Chronic Lymphocytic Leukemia -2.229 0.000
astrocytic glioma -1.400 0.002
posterior fossa group B ependymoma -1.800 0.000
oligodendroglioma -1.500 0.003
cutaneous lupus erythematosus 2.600 0.006
osteosarcoma -4.705 0.000
group 3 medulloblastoma -1.900 0.000
atypical teratoid / rhabdoid tumor -1.500 0.000
glioblastoma -1.200 0.000
lung cancer 1.600 0.002
interstitial cystitis 2.900 0.001
pilocytic astrocytoma -1.600 0.000
primary Sjogren syndrome 1.900 0.000
nasopharyngeal carcinoma -1.300 0.002
ulcerative colitis 1.700 0.004
psoriasis 1.100 0.000

Gene RIF (13)

PMID Text
25181038 These data indicate a functional role of the human P2RX5 splice variant in T cell activation and immunoregulation.
25080478 The amino acid transporter PAT2 and the purinergic receptor P2RX5 are cell surface markers expressed in classical brown and beige adipocytes.
24868547 sensory proteins P2X3 and TRPV1 are in correlation with urothelial differentiation, while P2X5 and TRPV4 have unique expression patterns
21092862 Purinergic receptor P2X5 binds to adenosine triphosphate (ATP) to form a molecular complex with ASIC3 (acid-sensing ion channel number 3) to detect muscle ischemia.
20223879 findings indicate that most humans express only a nonfunctional isoform of P2X5, which is in stark contrast to what is seen in other vertebrate species in which P2X5 has been studied, from which only the full-length isoform is known
19074734 These findings provide a rationale for use of LRH-1 as immunotherapeutic target antigen to treat residual or persisting myeloid malignancies after allogeneic stem cell transplantation
18976975 Knockdown of purinergic receptor P2X, ligand-gated ion channel, 5 (P2RX5) by siRNA has both activating and inhibiting activities on HIV-1 replication in HeLa P4/R5 cells, suggesting a regulatory role in HIV replication
18719914 LRH-1 is aberrantly expressed on solid tumor cells
17001079 analysis of topology, helix-helix interactions, and oligomerization of P2X5 subunits
16967306 Increased keratinocyte P2X(5) receptor activity may, in part, be accountable for epidermal thinning in chronic venous insufficiency.
More...

AA Sequence

MGQAGCKGLCLSLFDYKTEKYVIAKNKKVGLLYRLLQASILAYLVVWVFLIKKGYQDVDTSLQSAVITKV      1 - 70
KGVAFTNTSDLGQRIWDVADYVIPAQGENVFFVVTNLIVTPNQRQNVCAENEGIPDGACSKDSDCHAGEA     71 - 140
VTAGNGVKTGRCLRRENLARGTCEIFAWCPLETSSRPEEPFLKEAEDFTIFIKNHIRFPKFNFSKSNVMD    141 - 210
VKDRSFLKSCHFGPKNHYCPIFRLGSVIRWAGSDFQDIALEGGVIGINIEWNCDLDKAASECHPHYSFSR    211 - 280
LDNKLSKSVSSGYNFRFARYYRDAAGVEFRTLMKAYGIRFDVMVNGKGAFFCDLVLIYLIKKREFYRDKK    281 - 350
YEEVRGLEDSSQEAEDEASGLGLSEQLTSGPGLLGMPEQQELQEPPEAKRGSSSQKGNGSVCPQLLEPHR    351 - 420
ST                                                                        421 - 422
//

Text Mined References (26)

PMID Year Title
25181038 2014 A truncation variant of the cation channel P2RX5 is upregulated during T cell activation.
25080478 2014 ASC-1, PAT2, and P2RX5 are cell surface markers for white, beige, and brown adipocytes.
24868547 2014 Correlation between urothelial differentiation and sensory proteins P2X3, P2X5, TRPV1, and TRPV4 in normal urothelium and papillary carcinoma of human bladder.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21092862 2010 Sensing muscle ischemia: coincident detection of acid and ATP via interplay of two ion channels.
20962269 2011 P2Y1 and P2Y13 purinergic receptors mediate Ca2+ signaling and proliferative responses in pulmonary artery vasa vasorum endothelial cells.
20223879 2010 Genetic and functional analysis of human P2X5 reveals a distinct pattern of exon 10 polymorphism with predominant expression of the nonfunctional receptor isoform.
19074734 2009 Myeloid leukemic progenitor cells can be specifically targeted by minor histocompatibility antigen LRH-1-reactive cytotoxic T cells.
18719914 2009 Aberrant expression of the hematopoietic-restricted minor histocompatibility antigen LRH-1 on solid tumors results in efficient cytotoxic T cell-mediated lysis.
17895406 2007 Go it alone no more--P2X7 joins the society of heteromeric ATP-gated receptor channels.
More...