Property Summary

NCBI Gene PubMed Count 36
Grant Count 25
R01 Count 19
Funding $2,238,929.06
PubMed Score 90.16
PubTator Score 177.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Barrett's esophagus 1.600 0.026
psoriasis -2.300 0.000
osteosarcoma -3.974 0.000
periodontitis 1.200 0.000
medulloblastoma, large-cell 1.100 0.001
intraductal papillary-mucinous neoplasm ... -1.300 0.013
colon cancer -2.100 0.000
lung cancer -1.300 0.006
interstitial cystitis 2.000 0.004
cystic fibrosis -1.300 0.001
aldosterone-producing adenoma 1.981 0.016
lung carcinoma 1.600 0.000
ductal carcinoma in situ 1.100 0.043

Gene RIF (27)

PMID Text
25270119 we make a comprehensive analysis of the current knowledge of the role of the SERCA pumps in the pathophysiology of insulin-dependent diabetes mellitus type 1 (TIDM) and type 2 (T2DM) in the heart and beta-cells in the pancreas
24224513 Normal choroid plexus epithelial cells express SERCA3 abundantly, SERCA3 expression is strongly decreased in papillomas, and is absent in choroid plexus carcinoma, while expression in hyperplastic epithelium is high, similarly to normal epithelium.
24213720 aberrant SERCA3 expression is closely linked to the adenoma-adenocarcinoma sequence and progression of colorectal carcinomas.
23235306 The Ca2+-ATPase activity in cloned Plasmodiuim falciparum strain D6 protein is higher than in cloned strain W2 protein. The Ca2+-ATPase activity in isolates from malaria patients varied widely.
23157274 Loss of SERCA3 expression is associated with lung cancer.
22948776 High SERCA3 expression is associated with pathogenesis, invasion, metastasis of gastric carcinomas.
22190034 HIV-1 Env is identified to have a physical interaction with ATPase, Ca++ transporting, ubiquitous (ATP2A3) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
19962989 SERCA2 and SERCA3 isoforms have roles in the failing and failing human heart
19650915 Data show that low Ca2+-affinity SERCA3, and the high Ca2+-affinity SERCA2 enzymes are simultaneously expressed in B cells, and decreased SERCA3 expression during EBV-infection.
19225163 affinity for Ca(2+) is inherently lower for SERCA3 expressed in situ than for other SERCA isoforms
More...

AA Sequence

MEAAHLLPAADVLRHFSVTAEGGLSPAQVTGARERYGPNELPSEEGKSLWELVLEQFEDLLVRILLLAAL      1 - 70
VSFVLAWFEEGEETTTAFVEPLVIMLILVANAIVGVWQERNAESAIEALKEYEPEMGKVIRSDRKGVQRI     71 - 140
RARDIVPGDIVEVAVGDKVPADLRLIEIKSTTLRVDQSILTGESVSVTKHTEAIPDPRAVNQDKKNMLFS    141 - 210
GTNITSGKAVGVAVATGLHTELGKIRSQMAAVEPERTPLQRKLDEFGRQLSHAISVICVAVWVINIGHFA    211 - 280
DPAHGGSWLRGAVYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMARKNAIVRSLPSVETLGCTSVICS    281 - 350
DKTGTLTTNQMSVCRMFVVAEADAGSCLLHEFTISGTTYTPEGEVRQGDQPVRCGQFDGLVELATICALC    351 - 420
NDSALDYNEAKGVYEKVGEATETALTCLVEKMNVFDTDLQALSRVERAGACNTVIKQLMRKEFTLEFSRD    421 - 490
RKSMSVYCTPTRPHPTGQGSKMFVKGAPESVIERCSSVRVGSRTAPLTPTSREQILAKIRDWGSGSDTLR    491 - 560
CLALATRDAPPRKEDMELDDCSKFVQYETDLTFVGCVGMLDPPRPEVAACITRCYQAGIRVVMITGDNKG    561 - 630
TAVAICRRLGIFGDTEDVAGKAYTGREFDDLSPEQQRQACRTARCFARVEPAHKSRIVENLQSFNEITAM    631 - 700
TGDGVNDAPALKKAEIGIAMGSGTAVAKSAAEMVLSDDNFASIVAAVEEGRAIYSNMKQFIRYLISSNVG    701 - 770
EVVCIFLTAILGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMEKLPRSPREALISGWLFFRYLAI    771 - 840
GVYVGLATVAAATWWFVYDAEGPHINFYQLRNFLKCSEDNPLFAGIDCEVFESRFPTTMALSVLVTIEMC    841 - 910
NALNSVSENQSLLRMPPWMNPWLLVAVAMSMALHFLILLVPPLPLIFQVTPLSGRQWVVVLQISLPVILL    911 - 980
DEALKYLSRNHMHACLYPGLLRTVSQAWSRQPLTTSWTPDHTGRNEPEVSAGNRVESPVCTSD           981 - 1043
//

Text Mined References (41)

PMID Year Title
25270119 2014 Regulation of SERCA pumps expression in diabetes.
24224513 2014 Loss of endoplasmic reticulum calcium pump expression in choroid plexus tumours.
24213720 2014 Aberrant SERCA3 expression during the colorectal adenoma-adenocarcinoma sequence.
23235306 2012 Assessment and characterization of Ca2+-ATPase expression in selected isolates and clones of Plasmodium falciparum.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23157274 2013 Modulation of endoplasmic reticulum calcium pump expression during lung cancer cell differentiation.
22948776 2012 Aberrant SERCA3 expression is closely linked to pathogenesis, invasion, metastasis, and prognosis of gastric carcinomas.
21269460 2011 Initial characterization of the human central proteome.
19962989 2010 Multiple and diverse coexpression, location, and regulation of additional SERCA2 and SERCA3 isoforms in nonfailing and failing human heart.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...