Property Summary

NCBI Gene PubMed Count 20
PubMed Score 0.59
PubTator Score 0.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.400 3.5e-04
Breast cancer 1.700 1.3e-14
breast carcinoma 1.500 2.1e-04
cystic fibrosis 1.320 2.7e-04
ductal carcinoma in situ 2.300 1.9e-04
invasive ductal carcinoma 3.100 9.1e-04
lung adenocarcinoma 1.300 4.1e-13
lung cancer 1.900 4.7e-05
non-small cell lung cancer 1.322 2.4e-14
ovarian cancer 1.300 6.8e-05
pancreatic cancer 1.100 1.0e-04
psoriasis 1.600 4.2e-28
sonic hedgehog group medulloblastoma 1.300 3.5e-03

Gene RIF (5)

AA Sequence

MPDPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDI      1 - 70
FERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK                   71 - 126
//

Text Mined References (28)

PMID Year Title