Property Summary

NCBI Gene PubMed Count 22
PubMed Score 0.82
PubTator Score 4.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
breast carcinoma 1.400 7.8e-18
cutaneous lupus erythematosus 1.700 1.9e-03
cystic fibrosis 1.975 6.0e-06
Down syndrome 1.100 2.3e-03
ductal carcinoma in situ 1.900 6.8e-03
gastric cancer 1.300 4.7e-03
group 4 medulloblastoma -1.600 1.6e-03
hepatocellular carcinoma 1.300 6.5e-04
intraductal papillary-mucinous adenoma (... 1.700 8.3e-03
intraductal papillary-mucinous carcinoma... 2.100 2.4e-02
intraductal papillary-mucinous neoplasm ... 2.200 1.2e-02
invasive ductal carcinoma 2.200 2.4e-03
lung cancer 1.100 9.5e-04
Multiple myeloma 2.313 4.9e-03
ovarian cancer 1.300 1.5e-02
pancreatic cancer 2.200 2.2e-04
pancreatic carcinoma 2.200 2.2e-04
pituitary cancer 1.700 6.3e-04
primary pancreatic ductal adenocarcinoma 1.503 4.0e-02
psoriasis -1.500 1.4e-03
spina bifida -1.980 4.9e-02

Gene RIF (4)

AA Sequence

MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNA      1 - 70
ARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK               71 - 130
//

Text Mined References (37)

PMID Year Title