Property Summary

NCBI Gene PubMed Count 10
PubMed Score 55.79
PubTator Score 14.16

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (14)

Disease log2 FC p
psoriasis -2.400 4.5e-05
dermatomyositis 1.100 7.8e-03
Down syndrome 1.100 1.8e-02
glioblastoma -1.100 1.3e-03
group 3 medulloblastoma -1.100 1.8e-02
lung adenocarcinoma -1.200 1.1e-11
lung cancer -1.600 3.2e-04
malignant mesothelioma -1.200 7.5e-05
medulloblastoma, large-cell -1.900 1.0e-03
non-small cell lung cancer -1.909 8.8e-26
ovarian cancer -1.100 8.0e-04
Pick disease 1.300 1.4e-04
Rheumatoid arthritis 1.400 3.0e-02
spina bifida -1.324 3.8e-02

Synonym

Accession Q93073 Q8N767 SECIS-binding protein 2-like
Symbols SLAN
SBP2L

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MDRAPTEQNVKLSAEVEPFIPQKKSPDTFMIPMALPNDNGSVSGVEPTPIPSYLITCYPFVQENQSNRQF      1 - 70
PLYNNDIRWQQPNPNPTGPYFAYPIISAQPPVSTEYTYYQLMPAPCAQVMGFYHPFPTPYSNTFQAANTV     71 - 140
NAITTECTERPSQLGQVFPLSSHRSRNSNRGSVVPKQQLLQQHIKSKRPLVKNVATQKETNAAGPDSRSK    141 - 210
IVLLVDASQQTDFPSDIANKSLSETTATMLWKSKGRRRRASHPTAESSSEQGASEADIDSDSGYCSPKHS    211 - 280
NNQPAAGALRNPDSGTMNHVESSMCAGGVNWSNVTCQATQKKPWMEKNQTFSRGGRQTEQRNNSQVGFRC    281 - 350
RGHSTSSERRQNLQKRPDNKHLSSSQSHRSDPNSESLYFEDEDGFQELNENGNAKDENIQQKLSSKVLDD    351 - 420
LPENSPINIVQTPIPITTSVPKRAKSQKKKALAAALATAQEYSEISMEQKKLQEALSKAAGKKNKTPVQL    421 - 490
DLGDMLAALEKQQQAMKARQITNTRPLSYTVVTAASFHTKDSTNRKPLTKSQPCLTSFNSVDIASSKAKK    491 - 560
GKEKEIAKLKRPTALKKVILKEREEKKGRLTVDHNLLGSEEPTEMHLDFIDDLPQEIVSQEDTGLSMPSD    561 - 630
TSLSPASQNSPYCMTPVSQGSPASSGIGSPMASSTITKIHSKRFREYCNQVLCKEIDECVTLLLQELVSF    631 - 700
QERIYQKDPVRAKARRRLVMGLREVTKHMKLNKIKCVIISPNCEKIQSKGGLDEALYNVIAMAREQEIPF    701 - 770
VFALGRKALGRCVNKLVPVSVVGIFNYFGAESLFNKLVELTEEARKAYKDMVAAMEQEQAEEALKNVKKV    771 - 840
PHHMGHSRNPSAASAISFCSVISEPISEVNEKEYETNWRNMVETSDGLEASENEKEVSCKHSTSEKPSKL    841 - 910
PFDTPPIGKQPSLVATGSTTSATSAGKSTASDKEEVKPDDLEWASQQSTETGSLDGSCRDLLNSSITSTT    911 - 980
STLVPGMLEEEEDEDEEEEEDYTHEPISVEVQLNSRIESWVSETQRTMETLQLGKTLNGSEEDNVEQSGE    981 - 1050
EEAEAPEVLEPGMDSEAWTADQQASPGQQKSSNCSSLNKEHSDSNYTTQTT                      1051 - 1101
//

Text Mined References (10)

PMID Year Title