Property Summary

NCBI Gene PubMed Count 21
PubMed Score 26.46
PubTator Score 26.75

Knowledge Summary

Patent

No data available

Expression

Gene RIF (8)

PMID Text
25988428 Characterization of two novel DO*B alleles highlights the value of testing selected ethnic groups in understanding DO allele diversity.
23421541 The production, serologic evaluation, and epitope mapping of ten murine monoclonal Dombrock antibodies.
20932078 The Dombrock blood group system
20431033 Observational study of genetic testing. (HuGE Navigator)
19413734 Dombrock genotyping in a native Congolese cohort reveals two novel alleles.
18510579 Observational study of genetic testing. (HuGE Navigator)
16140404 Expression of ART4 was analyzed in mononuclear leukocytes.
15847654 Observational study of genetic testing. (HuGE Navigator)

AA Sequence

MGPLINRCKKILLPTTVPPATMRIWLLGGLLPFLLLLSGLQRPTEGSEVAIKIDFDFAPGSFDDQYQGCS      1 - 70
KQVMEKLTQGDYFTKDIEAQKNYFRMWQKAHLAWLNQGKVLPQNMTTTHAVAILFYTLNSNVHSDFTRAM     71 - 140
ASVARTPQQYERSFHFKYLHYYLTSAIQLLRKDSIMENGTLCYEVHYRTKDVHFNAYTGATIRFGQFLST    141 - 210
SLLKEEAQEFGNQTLFTIFTCLGAPVQYFSLKKEVLIPPYELFKVINMSYHPRGNWLQLRSTGNLSTYNC    211 - 280
QLLKASSKKCIPDPIAIASLSFLTSVIIFSKSRV                                        281 - 314
//

Text Mined References (22)

PMID Year Title
25988428 2015 Sequencing of the ART4 gene in sub-Saharan cohorts reveals ethnic differences and two new DO alleles: DO*B-Ile5Thr and DO*B-Trp266Arg.
23421541 2012 The production, serologic evaluation, and epitope mapping of ten murine monoclonal Dombrock antibodies.
20932078 2010 The Dombrock blood group system: a review.
20431033 2010 Single PCR multiplex SNaPshot reaction for detection of eleven blood group nucleotide polymorphisms: optimization, validation, and one year of routine clinical use.
20106667 2010 Toward a unified nomenclature for mammalian ADP-ribosyltransferases.
19413734 2009 Dombrock genotyping in a native Congolese cohort reveals two novel alleles.
18510579 2008 Introduction of a real-time-based blood-group genotyping approach.
16140404 2005 Analysis of mono-ADP-ribosyltransferase 4 gene expression in human monocytes: splicing pattern and potential regulatory elements.
16040347 2005 Analysis of the 3' UTR of the ART3 and ART4 gene by 3' inverse RACE-PCR.
15847654 2005 A flexible array format for large-scale, rapid blood group DNA typing.
More...