Property Summary

NCBI Gene PubMed Count 22
PubMed Score 27.61
PubTator Score 26.75

Knowledge Summary

Patent

No data available

Expression

Gene RIF (8)

AA Sequence

MGPLINRCKKILLPTTVPPATMRIWLLGGLLPFLLLLSGLQRPTEGSEVAIKIDFDFAPGSFDDQYQGCS      1 - 70
KQVMEKLTQGDYFTKDIEAQKNYFRMWQKAHLAWLNQGKVLPQNMTTTHAVAILFYTLNSNVHSDFTRAM     71 - 140
ASVARTPQQYERSFHFKYLHYYLTSAIQLLRKDSIMENGTLCYEVHYRTKDVHFNAYTGATIRFGQFLST    141 - 210
SLLKEEAQEFGNQTLFTIFTCLGAPVQYFSLKKEVLIPPYELFKVINMSYHPRGNWLQLRSTGNLSTYNC    211 - 280
QLLKASSKKCIPDPIAIASLSFLTSVIIFSKSRV                                        281 - 314
//

Text Mined References (23)

PMID Year Title