Property Summary

NCBI Gene PubMed Count 63
PubMed Score 520.62
PubTator Score 45.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
non-small cell lung cancer 2798 1.0110193311227E-10
psoriasis 6685 1.57373994643464E-10
tuberculosis and treatment for 3 months 327 1.51519507685103E-8
posterior fossa group A ependymoma 1511 2.98165360355032E-7
atypical teratoid / rhabdoid tumor 4369 3.21271889594557E-6
ovarian cancer 8492 6.46828000362921E-6
colon cancer 1475 8.25190265893099E-6
pilocytic astrocytoma 3086 1.14855049771403E-5
Pick disease 1893 6.6702080989119E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 1.00491125104039E-4
primary pancreatic ductal adenocarcinoma 1271 3.31891749055087E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 3.82559614835331E-4
acute quadriplegic myopathy 1157 6.19953721771823E-4
pancreatic cancer 2300 6.47555134647085E-4
group 4 medulloblastoma 1875 6.85598882209377E-4
medulloblastoma, large-cell 6234 7.39770867049501E-4
glioblastoma 5572 9.03084146177826E-4
chronic lymphocytic leukemia 244 0.00124565670912937
pediatric high grade glioma 2712 0.00146368185288486
lung cancer 4473 0.00327914301632151
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00451135769334925
astrocytoma 1493 0.00459391298631292
cystic fibrosis and chronic rhinosinusitis 213 0.00493044762368008
dermatomyositis 967 0.00564243727903689
osteosarcoma 7933 0.00590598716701179
subependymal giant cell astrocytoma 2287 0.00810933905498821
non primary Sjogren syndrome sicca 840 0.0113822478223754
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0119794259442341
Polycystic Ovary Syndrome 335 0.0123513805341515
gastric carcinoma 832 0.0356486456685504
Disease Target Count
Leukemia, Acute Myeloid 17

Expression

Synonym

Accession Q93052 A1L4L6 D3DNV6 Q8NFX5
Symbols

Gene

LPP

  Ortholog (6)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (26)

PMID Text
26028032 alteration of LPP expression markedly changes the collectiveness and metastatic potential of cancer cells
25279986 3q28 rs6444305 in LPP gene is associated with follicular lymphoma.
24334606 Results suggest that rs4686484 is the functional variant in this locus, while LPP expression is decreased in CeD.
23447672 interaction between LPP and alpha-actinin, an actin cross-linking protein, is necessary for TGFbeta-induced migration and invasion of ErbB2-expressing breast cancer cells.
23056290 Three polymorphisms of LPP gene were selected and replicated in additional 1132 PCOS cases and 1142 controls. Our results suggest that LPP gene might be a novel candidate for PCOS
22639458 The results suggest that genomic alterations and clearly deleterious sequence changes in the LPP gene are not a common cause of esophageal atresia/tracheoesophageal fistula or VACTERL association.
22404213 Knockdown of LIM domain containing preferred translocation partner in lipoma (LPP) by siRNA enhances HIV-1 replication in CD4+/CCR5+/CXCR4+ TZM-bl HeLa cells
20949626 haploinsufficiency of LPP may be a novel cause of conotruncal cardiac anomalies, particularly forms of tetralogy of Fallot
20647273 Observational study of gene-disease association. (HuGE Navigator)
20410501 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MSHPSWLPPKSTGEPLGHVPARMETTHSFGNPSISVSTQQPPKKFAPVVAPKPKYNPYKQPGGEGDFLPP      1 - 70
PPPPLDDSSALPSISGNFPPPPPLDEEAFKVQGNPGGKTLEERRSSLDAEIDSLTSILADLECSSPYKPR     71 - 140
PPQSSTGSTASPPVSTPVTGHKRMVIPNQPPLTATKKSTLKPQPAPQAGPIPVAPIGTLKPQPQPVPASY    141 - 210
TTASTSSRPTFNVQVKSAQPSPHYMAAPSSGQIYGSGPQGYNTQPVPVSGQCPPPSTRGGMDYAYIPPPG    211 - 280
LQPEPGYGYAPNQGRYYEGYYAAGPGYGGRNDSDPTYGQQGHPNTWKREPGYTPPGAGNQNPPGMYPVTG    281 - 350
PKKTYITDPVSAPCAPPLQPKGGHSGQLGPSSVAPSFRPEDELEHLTKKMLYDMENPPADEYFGRCARCG    351 - 420
ENVVGEGTGCTAMDQVFHVDCFTCIICNNKLRGQPFYAVEKKAYCEPCYINTLEQCNVCSKPIMERILRA    421 - 490
TGKAYHPHCFTCVMCHRSLDGIPFTVDAGGLIHCIEDFHKKFAPRCSVCKEPIMPAPGQEETVRIVALDR    491 - 560
DFHVHCYRCEDCGGLLSEGDNQGCYPLDGHILCKTCNSARIRVLTAKASTDL                      561 - 612
//

Text Mined References (70)

PMID Year Title
26028032 2016 LPP inhibits collective cell migration during lung cancer dissemination.
25279986 2014 Genome-wide association study identifies five susceptibility loci for follicular lymphoma outside the HLA region.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24681953 2015 Persistent STAT5 activation in myeloid neoplasms recruits p53 into gene regulation.
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
24465431 2014 Familial young-onset diabetes, pre-diabetes and cardiovascular disease are associated with genetic variants of DACH1 in Chinese.
24334606 2014 Fine mapping of the celiac disease-associated LPP locus reveals a potential functional variant.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23817571 2013 Meta-analysis of genome-wide association studies identifies ten loci influencing allergic sensitization.
23817569 2013 A genome-wide association meta-analysis of self-reported allergy identifies shared and allergy-specific susceptibility loci.
More...