Property Summary

NCBI Gene PubMed Count 33
PubMed Score 25.15
PubTator Score 20.95

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
ependymoma -1.200 2.0e-11
glioblastoma -1.300 1.2e-08
group 3 medulloblastoma -1.300 6.5e-04
lung carcinoma 1.300 1.5e-27
mucosa-associated lymphoid tissue lympho... 1.158 1.4e-02
oligodendroglioma 1.300 9.0e-03
osteosarcoma 1.009 1.7e-02
pediatric high grade glioma -1.200 8.7e-06
Pick disease -1.200 2.5e-03
subependymal giant cell astrocytoma -2.101 8.0e-03

Protein-protein Interaction (3)

Gene RIF (6)

AA Sequence

MGELFRSEEMTLAQLFLQSEAAYCCVSELGELGKVQFRDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEK      1 - 70
EIRKANIPIMDTGENPEVPFPRDMIDLEANFEKIENELKEINTNQEALKRNFLELTELKFILRKTQQFFD     71 - 140
EMADPDLLEESSSLLEPSEMGRGTPLRLGFVAGVINRERIPTFERMLWRVCRGNVFLRQAEIENPLEDPV    141 - 210
TGDYVHKSVFIIFFQGDQLKNRVKKICEGFRASLYPCPETPQERKEMASGVNTRIDDLQMVLNQTEDHRQ    211 - 280
RVLQAAAKNIRVWFIKVRKMKAIYHTLNLCNIDVTQKCLIAEVWCPVTDLDSIQFALRRGTEHSGSTVPS    281 - 350
ILNRMQTNQTPPTYNKTNKFTYGFQNIVDAYGIGTYREINPAPYTIITFPFLFAVMFGDFGHGILMTLFA    351 - 420
VWMVLRESRILSQKNENEMFSTVFSGRYIILLMGVFSMYTGLIYNDCFSKSLNIFGSSWSVRPMFTYNWT    421 - 490
EETLRGNPVLQLNPALPGVFGGPYPFGIDPIWNIATNKLTFLNSFKMKMSVILGIIHMLFGVSLSLFNHI    491 - 560
YFKKPLNIYFGFIPEIIFMTSLFGYLVILIFYKWTAYDAHTSENAPSLLIHFINMFLFSYPESGYSMLYS    561 - 630
GQKGIQCFLVVVALLCVPWMLLFKPLVLRRQYLRRKHLGTLNFGGIRVGNGPTEEDAEIIQHDQLSTHSE    631 - 700
DADEPSEDEVFDFGDTMVHQAIHTIEYCLGCISNTASYLRLWALSLAHAQLSEVLWTMVIHIGLSVKSLA    701 - 770
GGLVLFFFFTAFATLTVAILLIMEGLSAFLHALRLHWVEFQNKFYSGTGFKFLPFSFEHIREGKFEE       771 - 837
//

Text Mined References (38)

PMID Year Title