Property Summary

NCBI Gene PubMed Count 37
PubMed Score 93.32
PubTator Score 59.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma -3.300 7.2e-05
astrocytic glioma -3.000 2.1e-02
Astrocytoma, Pilocytic -4.800 4.9e-09
atypical teratoid / rhabdoid tumor -5.200 1.7e-05
Breast cancer -1.300 5.0e-02
colon cancer -1.700 2.8e-02
Crohn's disease -1.223 8.4e-04
cutaneous lupus erythematosus 1.600 1.1e-02
Down syndrome -1.100 3.1e-02
ependymoma -5.900 1.7e-03
glioblastoma -3.400 1.4e-06
intraductal papillary-mucinous adenoma (... -2.200 1.2e-03
intraductal papillary-mucinous carcinoma... -2.100 3.0e-03
lung carcinoma 1.400 8.2e-10
malignant mesothelioma 2.300 3.5e-07
medulloblastoma, large-cell -1.100 2.8e-04
oligodendroglioma -2.700 1.9e-02
Pick disease -2.300 1.5e-02
pituitary cancer 3.100 4.0e-05
psoriasis -1.600 8.0e-03

Gene RIF (14)

AA Sequence

MAKTAMAYKEKMKELSMLSLICSCFYPEPRNINIYTYDDMEVKQINKRASGQAFELILKPPSPISEAPRT      1 - 70
LASPKKKDLSLEEIQKKLEAAEERRKSQEAQVLKQLAEKREHEREVLQKALEENNNFSKMAEEKLILKME     71 - 140
QIKENREANLAAIIERLQEKERHAAEVRRNKELQVELSG                                   141 - 179
//

Text Mined References (41)

PMID Year Title