Property Summary

NCBI Gene PubMed Count 37
Grant Count 24
R01 Count 17
Funding $1,701,237.77
PubMed Score 89.98
PubTator Score 59.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
malignant mesothelioma 2.300 0.000
astrocytoma -5.500 0.001
posterior fossa group B ependymoma -6.700 0.000
oligodendroglioma -2.700 0.019
cutaneous lupus erythematosus 1.600 0.011
psoriasis -1.600 0.008
glioblastoma -4.700 0.015
atypical teratoid / rhabdoid tumor -6.000 0.000
medulloblastoma, large-cell -1.100 0.000
Crohn's disease -1.223 0.001
intraductal papillary-mucinous adenoma (... -2.200 0.001
intraductal papillary-mucinous carcinoma... -2.100 0.003
colon cancer -3.300 0.000
adult high grade glioma -4.200 0.000
pilocytic astrocytoma -5.400 0.000
Breast cancer -1.300 0.050
lung carcinoma 1.400 0.000
Pick disease -2.300 0.015
pituitary cancer 3.400 0.000
Down syndrome -1.400 0.021

Gene RIF (14)

PMID Text
24589734 STMN and SCG10 are similarly targeted by JNK but there are clear differences in JNK recognition and phosphorylation of the closely related family member, SCLIP.
24414001 RARB and STMN2 polymorphisms were not associated with sporadic CJD in the Korean population.
23893240 PAK4-SCG10 signaling occurs in gastric cancer cell invasion.
21273291 SCG10 is upregulated in the IKAP/Elp1-deficient familial dysautonomia cerebrum lending support to the concept that SCG10 elevation can alter the microtubule organization and dynamics
21215777 CaMy1 via SCG10 couples Ca(2+) signals with the dynamics of microtubules during neuronal outgrowth in the developing brain.
20802173 Overexpression of SCG10 is associated with Liver Fibrosis.
18996843 SCG10 acts as an effector downstream of Rnd1 to regulate axon extensions by modulating microtubule organization.
18611392 STMN2 appears a novel marker of osteogenesis and osteoblast per se, that could play a role in the regulation of the adipocyte/osteoblast balance.
18549247 SCLIP and SCG10 were colocalized to the Golgi apparatus of chromaffin cells in vivo and shared localization with CHGA as it transited the Golgi.
18452648 BRI3 associates with SCG10 and attenuates NGF-induced neurite outgrowth in PC12 cells.
More...

AA Sequence

MAKTAMAYKEKMKELSMLSLICSCFYPEPRNINIYTYDDMEVKQINKRASGQAFELILKPPSPISEAPRT      1 - 70
LASPKKKDLSLEEIQKKLEAAEERRKSQEAQVLKQLAEKREHEREVLQKALEENNNFSKMAEEKLILKME     71 - 140
QIKENREANLAAIIERLQEKERHAAEVRRNKELQVELSG                                   141 - 179
//

Text Mined References (41)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24589734 2014 Differences in c-Jun N-terminal kinase recognition and phosphorylation of closely related stathmin-family members.
24414001 2014 RARB and STMN2 polymorphisms are not associated with sporadic Creutzfeldt-Jakob disease (CJD) in the Korean population.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23893240 2014 PAK4 kinase-mediated SCG10 phosphorylation involved in gastric cancer metastasis.
21471001 2011 Subcellular Golgi localization of stathmin family proteins is promoted by a specific set of DHHC palmitoyl transferases.
21273291 2011 IKAP/Elp1 involvement in cytoskeleton regulation and implication for familial dysautonomia.
21215777 2011 Calmyrin1 binds to SCG10 protein (stathmin2) to modulate neurite outgrowth.
20883670 2010 Cord blood administration induces oligodendrocyte survival through alterations in gene expression.
20802173 2010 SCG10 expression on activation of hepatic stellate cells promotes cell motility through interference with microtubules.
More...