Property Summary

NCBI Gene PubMed Count 54
Grant Count 270
R01 Count 178
Funding $41,145,194.92
PubMed Score 1848.40
PubTator Score 889.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
psoriasis -1.300 0.000
cutaneous lupus erythematosus -1.500 0.003
osteosarcoma 1.303 0.000
glioblastoma -1.500 0.015
medulloblastoma, large-cell -2.100 0.019
tuberculosis -1.300 0.000
pancreatic ductal adenocarcinoma liver m... 1.082 0.028
lung cancer 1.600 0.027
breast carcinoma -1.100 0.000
pediatric high grade glioma -1.200 0.016
pilocytic astrocytoma -1.400 0.004
lung adenocarcinoma 1.200 0.001
Pick disease -2.000 0.000

Synonym

Gene

Gene RIF (36)

PMID Text
26810853 Biologics beyond TNF-alpha inhibitors and the effect of targeting the homologues TL1A-DR3 pathway in chronic inflammatory disorders.
26509650 DR3 is efficiently activated by soluble TL1A trimers.
26393680 Higher DR3 levels were associated with early stage chronic lymphocytic leukemia.
26065008 These data identify new roles for DR3 in regulating OB-dependent bone mineral apposition.
26046454 DR3 is expressed by IL-22-producing human group 3 innate lymphoid cells (ILC3s).
25929035 The changes in frequency of occurrence of spliced variants of DR3/LARD mRNA were directed towards modulation of apoptosis and restraint of antiviral immune response.
25509355 Distinctions in occurrence of spectrums of DR3/LARD mRNA at healthy volunteers and colon cancer patients can define a different susceptibility of immunocompetent and tumor cells for apoptosis
25399326 DR3 is expressed in some interstitial vascular endothelial cells in human kidney in situ. These EC also respond to TL1A by activating NF-kappaB. Very low levels of DR3 are seen on the cell surface of HUVEC, which do not respond to TL1A.
25370568 Silencing of the DR3 gene affect levels of apoptosis antigen3 ligand in cells.
25269704 Human memory IL-18Ralpha and DR3 CD4+ T cells may contribute to antigen-independent innate responses at barrier surfaces.
More...

AA Sequence

MEQRPRGCAAVAAALLLVLLGARAQGGTRSPRCDCAGDFHKKIGLFCCRGCPAGHYLKAPCTEPCGNSTC      1 - 70
LVCPQDTFLAWENHHNSECARCQACDEQASQVALENCSAVADTRCGCKPGWFVECQVSQCVSSSPFYCQP     71 - 140
CLDCGALHRHTRLLCSRRDTDCGTCLPGFYEHGDGCVSCPTSTLGSCPERCAAVCGWRQMFWVQVLLAGL    141 - 210
VVPLLLGATLTYTYRHCWPHKPLVTADEAGMEALTPPPATHLSPLDSAHTLLAPPDSSEKICTVQLVGNS    211 - 280
WTPGYPETQEALCPQVTWSWDQLPSRALGPAAAPTLSPESPAGSPAMMLQPGPQLYDVMDAVPARRWKEF    281 - 350
VRTLGLREAEIEAVEVEIGRFRDQQYEMLKRWRQQQPAGLGAVYAALERMGLDGCVEDLRSRLQRGP       351 - 417
//

Text Mined References (56)

PMID Year Title
26810853 2016 Biologics beyond TNF-? inhibitors and the effect of targeting the homologues TL1A-DR3 pathway in chronic inflammatory disorders.
26509650 2016 Soluble TL1A is sufficient for activation of death receptor 3.
26393680 2015 Expression and function of the TL1A/DR3 axis in chronic lymphocytic leukemia.
26072972 2015 TL1A as a Potential Local Inducer of IL17A Expression in Colon Mucosa of Inflammatory Bowel Disease Patients.
26065008 2015 Death Receptor 3 (TNFRSF25) Increases Mineral Apposition by Osteoblasts and Region Specific New Bone Formation in the Axial Skeleton of Male DBA/1 Mice.
26046454 2015 Human group3 innate lymphoid cells express DR3 and respond to TL1A with enhanced IL-22 production and IL-2-dependent proliferation.
25929035 2014 [Frequency of the occurrence of spliced variants of the messenger RNA DR3/LARD in herpesviral infection].
25509355 [DR3/LARD mRNA spliced variants' frequency at colorectal cancer].
25399326 2014 TL1-A can engage death receptor-3 and activate NF-kappa B in endothelial cells.
25370568 2015 The role of death receptor 3 in the biological behavior of hepatocellular carcinoma cells.
More...