Property Summary

NCBI Gene PubMed Count 60
PubMed Score 1888.24
PubTator Score 889.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Astrocytoma, Pilocytic -1.300 3.7e-03
breast carcinoma -1.100 4.3e-04
cutaneous lupus erythematosus -1.400 9.1e-04
glioblastoma -1.100 1.7e-03
lung adenocarcinoma 1.200 1.0e-03
lung cancer 1.600 2.7e-02
medulloblastoma, large-cell -2.100 1.9e-02
osteosarcoma 1.303 6.5e-06
pancreatic ductal adenocarcinoma liver m... 1.082 2.8e-02
pediatric high grade glioma -1.100 1.4e-02
Pick disease -1.100 6.0e-04
psoriasis -1.200 3.1e-06
tuberculosis -1.300 3.4e-04

Gene RIF (42)

AA Sequence

MEQRPRGCAAVAAALLLVLLGARAQGGTRSPRCDCAGDFHKKIGLFCCRGCPAGHYLKAPCTEPCGNSTC      1 - 70
LVCPQDTFLAWENHHNSECARCQACDEQASQVALENCSAVADTRCGCKPGWFVECQVSQCVSSSPFYCQP     71 - 140
CLDCGALHRHTRLLCSRRDTDCGTCLPGFYEHGDGCVSCPTSTLGSCPERCAAVCGWRQMFWVQVLLAGL    141 - 210
VVPLLLGATLTYTYRHCWPHKPLVTADEAGMEALTPPPATHLSPLDSAHTLLAPPDSSEKICTVQLVGNS    211 - 280
WTPGYPETQEALCPQVTWSWDQLPSRALGPAAAPTLSPESPAGSPAMMLQPGPQLYDVMDAVPARRWKEF    281 - 350
VRTLGLREAEIEAVEVEIGRFRDQQYEMLKRWRQQQPAGLGAVYAALERMGLDGCVEDLRSRLQRGP       351 - 417
//

Text Mined References (62)

PMID Year Title