Property Summary

NCBI Gene PubMed Count 62
Grant Count 95
R01 Count 39
Funding $7,269,271.81
PubMed Score 89.08
PubTator Score 71.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Rheumatoid Arthritis 1.100 0.012
Waldenstrons macroglobulinemia 1.315 0.016
Multiple myeloma 1.401 0.001
malignant mesothelioma 1.300 0.000
psoriasis -1.100 0.003
osteosarcoma 1.345 0.001
ovarian cancer -1.500 0.000

Synonym

Accession Q93034 A8K960 O14766 Q9BZC6 CUL-5
Symbols VACM1
VACM-1

Gene

PANTHER Protein Class (2)

PDB

4N9F   3DPL   3DQV   4JGH  

Gene RIF (141)

PMID Text
26253693 Studies indicate that Cullin-RING E3 ubiquitin ligases (CRL) are key players of the ubiquitylation pathway.
26241003 HIV-1 Vif interacts with CUL5 as demonstrated by co-immunoprecipitation assay
25912140 HIV-1 Vif interacts with CUL5 as demonstrated by co-immunoprecipitation assay
25912140 HIV-1 Vif interacts with CUL5 as demonstrated by co-immunoprecipitation assay
25912140 HIV-1 Vif interacts with CUL5 as demonstrated by co-immunoprecipitation assay
25912140 HIV-1 Vif interacts with CUL5 as demonstrated by co-immunoprecipitation assay
25901786 HIV-1 Vif interacts with CUL5 as demonstrated by co-immunoprecipitation assay
25424878 These results provide important information on the assembly of the Vif-CUL5-E3 ubiquitin ligase and identify a new viV binding interface with CBF-beta at the C-terminus of HIV-1 Vif.
25408426 HIV-1 Vif interacts with CUL5 as demonstrated by co-immunoprecipitation assay
25142583 HIV-1 Vif interacts with CUL5 as demonstrated by co-immunoprecipitation assay
More...

AA Sequence

MATSNLLKNKGSLQFEDKWDFMRPIVLKLLRQESVTKQQWFDLFSDVHAVCLWDDKGPAKIHQALKEDIL      1 - 70
EFIKQAQARVLSHQDDTALLKAYIVEWRKFFTQCDILPKPFCQLEITLMGKQGSNKKSNVEDSIVRKLML     71 - 140
DTWNESIFSNIKNRLQDSAMKLVHAERLGEAFDSQLVIGVRESYVNLCSNPEDKLQIYRDNFEKAYLDST    141 - 210
ERFYRTQAPSYLQQNGVQNYMKYADAKLKEEEKRALRYLETRRECNSVEALMECCVNALVTSFKETILAE    211 - 280
CQGMIKRNETEKLHLMFSLMDKVPNGIEPMLKDLEEHIISAGLADMVAAAETITTDSEKYVEQLLTLFNR    281 - 350
FSKLVKEAFQDDPRFLTARDKAYKAVVNDATIFKLELPLKQKGVGLKTQPESKCPELLANYCDMLLRKTP    351 - 420
LSKKLTSEEIEAKLKEVLLVLKYVQNKDVFMRYHKAHLTRRLILDISADSEIEENMVEWLREVGMPADYV    421 - 490
NKLARMFQDIKVSEDLNQAFKEMHKNNKLALPADSVNIKILNAGAWSRSSEKVFVSLPTELEDLIPEVEE    491 - 560
FYKKNHSGRKLHWHHLMSNGIITFKNEVGQYDLEVTTFQLAVLFAWNQRPREKISFENLKLATELPDAEL    561 - 630
RRTLWSLVAFPKLKRQVLLYEPQVNSPKDFTEGTLFSVNQEFSLIKNAKVQKRGKINLIGRLQLTTERMR    631 - 700
EEENEGIVQLRILRTQEAIIQIMKMRKKISNAQLQTELVEILKNMFLPQKKMIKEQIEWLIEHKYIRRDE    701 - 770
SDINTFIYMA                                                                771 - 780
//

Text Mined References (66)

PMID Year Title
26253693 2016 Cullin 5-RING E3 ubiquitin ligases, new therapeutic targets?
25424878 2014 Requirement of HIV-1 Vif C-terminus for Vif-CBF-? interaction and assembly of CUL5-containing E3 ligase.
25416956 2014 A proteome-scale map of the human interactome network.
25108430 2014 [Cell surface adhesion molecules mediated stretch-induced HL-60 cell adhesion to mouse common carotid arteries].
24760825 2014 E3 ubiquitin ligase Cullin-5 modulates multiple molecular and cellular responses to heat shock protein 90 inhibition in human cancer cells.
24422669 2014 HIV-1 Vif N-terminal motif is required for recruitment of Cul5 to suppress APOBEC3.
24402281 2014 Structural basis for hijacking CBF-? and CUL5 E3 ligase complex by HIV-1 Vif.
24390335 2014 Evolutionarily conserved requirement for core binding factor beta in the assembly of the human immunodeficiency virus/simian immunodeficiency virus Vif-cullin 5-RING E3 ubiquitin ligase.
24390320 2014 Core binding factor beta plays a critical role by facilitating the assembly of the Vif-cullin 5 E3 ubiquitin ligase.
24339204 2013 Downregulation of miR-7 upregulates Cullin 5 (CUL5) to facilitate G1/S transition in human hepatocellular carcinoma cells.
More...