Property Summary

NCBI Gene PubMed Count 65
PubMed Score 91.83
PubTator Score 71.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Breast Neoplasms 445 0.0 0.0
Disease Target Count
Mammary Neoplasms 425
Disease Target Count P-value
malignant mesothelioma 3232 3.0e-06
ovarian cancer 8520 1.6e-04
osteosarcoma 7950 1.1e-03
Multiple myeloma 1332 1.3e-03
psoriasis 6694 3.0e-03
Rheumatoid arthritis 1191 1.2e-02
Waldenstrons macroglobulinemia 765 1.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Liver cancer 604 0.0 0.5

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma 1.300 3.0e-06
Multiple myeloma 1.401 1.3e-03
osteosarcoma 1.345 1.1e-03
ovarian cancer -1.500 1.6e-04
psoriasis -1.100 3.0e-03
Rheumatoid arthritis 1.100 1.2e-02
Waldenstrons macroglobulinemia 1.315 1.6e-02

 GWAS Trait (1)

Gene RIF (81)

AA Sequence

MATSNLLKNKGSLQFEDKWDFMRPIVLKLLRQESVTKQQWFDLFSDVHAVCLWDDKGPAKIHQALKEDIL      1 - 70
EFIKQAQARVLSHQDDTALLKAYIVEWRKFFTQCDILPKPFCQLEITLMGKQGSNKKSNVEDSIVRKLML     71 - 140
DTWNESIFSNIKNRLQDSAMKLVHAERLGEAFDSQLVIGVRESYVNLCSNPEDKLQIYRDNFEKAYLDST    141 - 210
ERFYRTQAPSYLQQNGVQNYMKYADAKLKEEEKRALRYLETRRECNSVEALMECCVNALVTSFKETILAE    211 - 280
CQGMIKRNETEKLHLMFSLMDKVPNGIEPMLKDLEEHIISAGLADMVAAAETITTDSEKYVEQLLTLFNR    281 - 350
FSKLVKEAFQDDPRFLTARDKAYKAVVNDATIFKLELPLKQKGVGLKTQPESKCPELLANYCDMLLRKTP    351 - 420
LSKKLTSEEIEAKLKEVLLVLKYVQNKDVFMRYHKAHLTRRLILDISADSEIEENMVEWLREVGMPADYV    421 - 490
NKLARMFQDIKVSEDLNQAFKEMHKNNKLALPADSVNIKILNAGAWSRSSEKVFVSLPTELEDLIPEVEE    491 - 560
FYKKNHSGRKLHWHHLMSNGIITFKNEVGQYDLEVTTFQLAVLFAWNQRPREKISFENLKLATELPDAEL    561 - 630
RRTLWSLVAFPKLKRQVLLYEPQVNSPKDFTEGTLFSVNQEFSLIKNAKVQKRGKINLIGRLQLTTERMR    631 - 700
EEENEGIVQLRILRTQEAIIQIMKMRKKISNAQLQTELVEILKNMFLPQKKMIKEQIEWLIEHKYIRRDE    701 - 770
SDINTFIYMA                                                                771 - 780
//

Text Mined References (69)

PMID Year Title