Property Summary

NCBI Gene PubMed Count 17
Grant Count 21
R01 Count 5
Funding $1,741,853.99
PubMed Score 32.25
PubTator Score 28.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Rheumatoid Arthritis -1.800 0.040
psoriasis -1.200 0.000
osteosarcoma -2.118 0.000
lung adenocarcinoma -1.100 0.000
adult high grade glioma 1.100 0.000
lung carcinoma -1.700 0.000
mucosa-associated lymphoid tissue lympho... 1.151 0.022

Gene RIF (5)

PMID Text
25421756 Low expression of CD39(+) /CD45RA(+) on regulatory T cells (Treg ) cells in type 1 diabetic children in contrast to high expression of CD101(+) /CD129(+) on Treg cells in children with coeliac disease.
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 downregulates the expression of CD101 (IGSF2) in peptide-treated PBMCs
21467233 Single Nucleotide Polymorphism in CD101 gene may be associated with pancreatic cancer.
21159825 Results suggest a possible role for CD101 expression and function in the control of certain manifestations of rheumatoid arthritis pathology.
19898481 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAGISYVASFFLLLTKLSIGQREVTVQKGPLFRAEGYPVSIGCNVTGHQGPSEQHFQWSVYLPTNPTQEV      1 - 70
QIISTKDAAFSYAVYTQRVRSGDVYVERVQGNSVLLHISKLQMKDAGEYECHTPNTDEKYYGSYSAKTNL     71 - 140
IVIPDTLSATMSSQTLGKEEGEPLALTCEASKATAQHTHLSVTWYLTQDGGGSQATEIISLSKDFILVPG    141 - 210
PLYTERFAASDVQLNKLGPTTFRLSIERLQSSDQGQLFCEATEWIQDPDETWMFITKKQTDQTTLRIQPA    211 - 280
VKDFQVNITADSLFAEGKPLELVCLVVSSGRDPQLQGIWFFNGTEIAHIDAGGVLGLKNDYKERASQGEL    281 - 350
QVSKLGPKAFSLKIFSLGPEDEGAYRCVVAEVMKTRTGSWQVLQRKQSPDSHVHLRKPAARSVVMSTKNK    351 - 420
QQVVWEGETLAFLCKAGGAESPLSVSWWHIPRDQTQPEFVAGMGQDGIVQLGASYGVPSYHGNTRLEKMD    421 - 490
WATFQLEITFTAITDSGTYECRVSEKSRNQARDLSWTQKISVTVKSLESSLQVSLMSRQPQVMLTNTFDL    491 - 560
SCVVRAGYSDLKVPLTVTWQFQPASSHIFHQLIRITHNGTIEWGNFLSRFQKKTKVSQSLFRSQLLVHDA    561 - 630
TEEETGVYQCEVEVYDRNSLYNNRPPRASAISHPLRIAVTLPESKLKVNSRSQVQELSINSNTDIECSIL    631 - 700
SRSNGNLQLAIIWYFSPVSTNASWLKILEMDQTNVIKTGDEFHTPQRKQKFHTEKVSQDLFQLHILNVED    701 - 770
SDRGKYHCAVEEWLLSTNGTWHKLGEKKSGLTELKLKPTGSKVRVSKVYWTENVTEHREVAIRCSLESVG    771 - 840
SSATLYSVMWYWNRENSGSKLLVHLQHDGLLEYGEEGLRRHLHCYRSSSTDFVLKLHQVEMEDAGMYWCR    841 - 910
VAEWQLHGHPSKWINQASDESQRMVLTVLPSEPTLPSRICSSAPLLYFLFICPFVLLLLLLISLLCLYWK    911 - 980
ARKLSTLRSNTRKEKALWVDLKEAGGVTTNRREDEEEDEGN                                 981 - 1021
//

Text Mined References (18)

PMID Year Title
25421756 2015 Low expression of CD39(+) /CD45RA(+) on regulatory T cells (Treg ) cells in type 1 diabetic children in contrast to high expression of CD101(+) /CD129(+) on Treg cells in children with coeliac disease.
21467233 2011 Inflammation-related gene variants as risk factors for pancreatic cancer.
21159825 2011 CD101 expression and function in normal and rheumatoid arthritis-affected human T cells and monocytes/macrophages.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19898481 2009 Genetic variants at CD28, PRDM1 and CD2/CD58 are associated with rheumatoid arthritis risk.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15737213 2005 CD4+ CD56+ blastic tumor cells express CD101 molecules.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...