Property Summary

NCBI Gene PubMed Count 19
PubMed Score 41.32
PubTator Score 28.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Candidiasis 55 4.985 2.5

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma 1.100 8.4e-05
lung adenocarcinoma -1.100 6.9e-16
lung carcinoma -1.700 9.8e-15
mucosa-associated lymphoid tissue lympho... 1.151 2.2e-02
osteosarcoma -2.118 4.1e-06
psoriasis -1.200 4.4e-04
Rheumatoid arthritis -1.800 4.0e-02

Gene RIF (7)

AA Sequence

MAGISYVASFFLLLTKLSIGQREVTVQKGPLFRAEGYPVSIGCNVTGHQGPSEQHFQWSVYLPTNPTQEV      1 - 70
QIISTKDAAFSYAVYTQRVRSGDVYVERVQGNSVLLHISKLQMKDAGEYECHTPNTDEKYYGSYSAKTNL     71 - 140
IVIPDTLSATMSSQTLGKEEGEPLALTCEASKATAQHTHLSVTWYLTQDGGGSQATEIISLSKDFILVPG    141 - 210
PLYTERFAASDVQLNKLGPTTFRLSIERLQSSDQGQLFCEATEWIQDPDETWMFITKKQTDQTTLRIQPA    211 - 280
VKDFQVNITADSLFAEGKPLELVCLVVSSGRDPQLQGIWFFNGTEIAHIDAGGVLGLKNDYKERASQGEL    281 - 350
QVSKLGPKAFSLKIFSLGPEDEGAYRCVVAEVMKTRTGSWQVLQRKQSPDSHVHLRKPAARSVVMSTKNK    351 - 420
QQVVWEGETLAFLCKAGGAESPLSVSWWHIPRDQTQPEFVAGMGQDGIVQLGASYGVPSYHGNTRLEKMD    421 - 490
WATFQLEITFTAITDSGTYECRVSEKSRNQARDLSWTQKISVTVKSLESSLQVSLMSRQPQVMLTNTFDL    491 - 560
SCVVRAGYSDLKVPLTVTWQFQPASSHIFHQLIRITHNGTIEWGNFLSRFQKKTKVSQSLFRSQLLVHDA    561 - 630
TEEETGVYQCEVEVYDRNSLYNNRPPRASAISHPLRIAVTLPESKLKVNSRSQVQELSINSNTDIECSIL    631 - 700
SRSNGNLQLAIIWYFSPVSTNASWLKILEMDQTNVIKTGDEFHTPQRKQKFHTEKVSQDLFQLHILNVED    701 - 770
SDRGKYHCAVEEWLLSTNGTWHKLGEKKSGLTELKLKPTGSKVRVSKVYWTENVTEHREVAIRCSLESVG    771 - 840
SSATLYSVMWYWNRENSGSKLLVHLQHDGLLEYGEEGLRRHLHCYRSSSTDFVLKLHQVEMEDAGMYWCR    841 - 910
VAEWQLHGHPSKWINQASDESQRMVLTVLPSEPTLPSRICSSAPLLYFLFICPFVLLLLLLISLLCLYWK    911 - 980
ARKLSTLRSNTRKEKALWVDLKEAGGVTTNRREDEEEDEGN                                 981 - 1021
//

Text Mined References (20)

PMID Year Title