Property Summary

NCBI Gene PubMed Count 123
Grant Count 75
R01 Count 50
Funding $5,684,517.8
PubMed Score 165.65
PubTator Score 135.44

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q93009 A6NMY8 B7Z815 H0Y3G8
Symbols TEF1
HAUSP

Gene

PDB

2F1X   2FOJ   2FOO   4KG9   4YOC   5JTJ   1NBF   5C6D   1NB8   1YY6   1YZE   2F1W   2F1Y   2F1Z   2FOP   2KVR   2XXN   2YLM   3MQR   3MQS   4JJQ   4M5W   4M5X   4PYZ   4WPH   4WPI   4YSI   5C56   5FWI   5J7T  

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
624341 other 3 / 0 / 0 Inhibitors of USP1/UAF1: Hit Validation in USP7 Diubiquiting Gel Assay
651624 other 0 / 0 / 1 Inhibitors of USP1/UAF1: SAR in USP7 diubiquitin SDS-PAGE gel assay

Gene RIF (92)

PMID Text
26950370 This study identified USP7 as a replisome-enriched SUMO deubiquitinase that is essential for DNA replication.
26786098 USP7 interacts with vIRF1 in U2OS cells.
26768359 Taken together, our results reveal that oxidative and ER stress, rather than the Mdm2-p53 axis, mainly contributes to USP7 inhibitor-mediated apoptosis in cancer cells.
26673319 USP7 suppresses H2O2-induced mutagenesis involving cell-cycle-independent processes such as DNA repair.
26460617 We now report the identification of a novel molecular function of STIP that links USP7 to the p53-Mdm2 pathway
26365382 The USP7 deubiquitinating enzyme is an integral component of the MAGE-L2-TRIM27 ligase and is essential for WASH-mediated endosomal actin assembly and protein recycling.
26299963 USP7 allosterically regulates the conformational states of UHRF1 and affects chromatin association of UHRF1.
26238070 HAUSP-nucleolin interaction is regulated by p53-Mdm2 complex in response to DNA damage.
26224631 USP7 directly binds ICP0 via its C-terminal UBL1-2 domains and mapped the USP7-binding site for ICP0.
26175158 USP7 associates with AR in an androgen-dependent manner and mediates AR deubiquitination.
More...

AA Sequence

MNHQQQQQQQKAGEQQLSEPEDMEMEAGDTDDPPRITQNPVINGNVALSDGHNTAEEDMEDDTSWRSEAT      1 - 70
FQFTVERFSRLSESVLSPPCFVRNLPWKIMVMPRFYPDRPHQKSVGFFLQCNAESDSTSWSCHAQAVLKI     71 - 140
INYRDDEKSFSRRISHLFFHKENDWGFSNFMAWSEVTDPEKGFIDDDKVTFEVFVQADAPHGVAWDSKKH    141 - 210
TGYVGLKNQGATCYMNSLLQTLFFTNQLRKAVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGTKKLT    211 - 280
KSFGWETLDSFMQHDVQELCRVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKEVDYRSDRREDYYDI    281 - 350
QLSIKGKKNIFESFVDYVAVEQLDGDNKYDAGEHGLQEAEKGVKFLTLPPVLHLQLMRFMYDPQTDQNIK    351 - 420
INDRFEFPEQLPLDEFLQKTDPKDPANYILHAVLVHSGDNHGGHYVVYLNPKGDGKWCKFDDDVVSRCTK    421 - 490
EEAIEHNYGGHDDDLSVRHCTNAYMLVYIRESKLSEVLQAVTDHDIPQQLVERLQEEKRIEAQKRKERQE    491 - 560
AHLYMQVQIVAEDQFCGHQGNDMYDEEKVKYTVFKVLKNSSLAEFVQSLSQTMGFPQDQIRLWPMQARSN    561 - 630
GTKRPAMLDNEADGNKTMIELSDNENPWTIFLETVDPELAASGATLPKFDKDHDVMLFLKMYDPKTRSLN    631 - 700
YCGHIYTPISCKIRDLLPVMCDRAGFIQDTSLILYEEVKPNLTERIQDYDVSLDKALDELMDGDIIVFQK    701 - 770
DDPENDNSELPTAKEYFRDLYHRVDVIFCDKTIPNDPGFVVTLSNRMNYFQVAKTVAQRLNTDPMLLQFF    771 - 840
KSQGYRDGPGNPLRHNYEGTLRDLLQFFKPRQPKKLYYQQLKMKITDFENRRSFKCIWLNSQFREEEITL    841 - 910
YPDKHGCVRDLLEECKKAVELGEKASGKLRLLEIVSYKIIGVHQEDELLECLSPATSRTFRIEEIPLDQV    911 - 980
DIDKENEMLVTVAHFHKEVFGTFGIPFLLRIHQGEHFREVMKRIQSLLDIQEKEFEKFKFAIVMMGRHQY    981 - 1050
INEDEYEVNLKDFEPQPGNMSHPRPWLGLDHFNKAPKRSRYTYLEKAIKIHN                     1051 - 1102
//

Text Mined References (138)

PMID Year Title
26950370 2016 USP7 is a SUMO deubiquitinase essential for DNA replication.
26786098 2016 Identification of Kaposi Sarcoma Herpesvirus (KSHV) vIRF1 Protein as a Novel Interaction Partner of Human Deubiquitinase USP7.
26768359 2016 Small-molecule inhibitors of USP7 induce apoptosis through oxidative and endoplasmic reticulum stress in cancer cells.
26673319 2015 USP7 Is a Suppressor of PCNA Ubiquitination and Oxidative-Stress-Induced Mutagenesis in Human Cells.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26460617 2015 STIP is a critical nuclear scaffolding protein linking USP7 to p53-Mdm2 pathway regulation.
26365382 2015 USP7 Acts as a Molecular Rheostat to Promote WASH-Dependent Endosomal Protein Recycling and Is Mutated in a Human Neurodevelopmental Disorder.
26299963 2015 An Allosteric Interaction Links USP7 to Deubiquitination and Chromatin Targeting of UHRF1.
26238070 2015 HAUSP-nucleolin interaction is regulated by p53-Mdm2 complex in response to DNA damage response.
26224631 2015 Structural Characterization of Interaction between Human Ubiquitin-specific Protease 7 and Immediate-Early Protein ICP0 of Herpes Simplex Virus-1.
More...