Property Summary

NCBI Gene PubMed Count 48
Grant Count 11
R01 Count 4
Funding $424,071.6
PubMed Score 28.36
PubTator Score 28.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
sonic hedgehog group medulloblastoma 1.300 0.000
astrocytoma 2.200 0.002
glioblastoma 1.100 0.000
non-small cell lung cancer 1.223 0.000
lung cancer 1.100 0.003
ovarian cancer 1.800 0.000

 GWAS Trait (1)

Gene RIF (19)

PMID Text
27008544 we demonstrate that normally ALFY attenuates the canonical Wnt signaling pathway via autophagy-dependent removal specifically of aggregates of DVL3 and not of Dvl1 or Dvl2.
26924530 All variants in DVL3 result in a -1 frameshift, indicating that these highly specific alterations might be a common cause of dominant Robinow syndrome.
26008736 DVL3 transcripts decreased in individuals with major depressive disorder
25847080 data suggest that miR-204-5p regulates adipogenesis by controlling DVL3 expression and subsequently inhibiting the activation of the Wnt/beta-catenin signaling pathway.
25168481 Tumors that responded to IGFIR inhibition contain relatively lower levels of DVL3 protein than resistant tumors.
25156800 findings confirm that p38 and PAX2 are important for the Dvl-3 induced upregulation of p120ctn
24993822 data (i) support previous the assumption that CK1 acts via phosphorylation of distinct residues as the activator as well as the shut-off signal of Wnt/beta-catenin signaling and (ii) suggest that CK1 acts on Dvl via different mechanism than Fzd5.
24427302 High expression of IGFBP7 in fibroblasts induced by colorectal cancer cells is co-regulated by TGF-beta and Wnt signaling in a Smad2/3-Dvl2/3-dependent manner.
24040443 Study showed an association of DVL-1 and DVL-3 with Hirschsprung's disease.
23301094 AMPK activators suppress cervical cancer cell growth by impairing DVL3 protein synthesis via AMPK/mTOR signaling and/or partially promoting the proteasomal degradation of DVL3
More...

AA Sequence

MGETKIIYHLDGQETPYLVKLPLPAERVTLADFKGVLQRPSYKFFFKSMDDDFGVVKEEISDDNAKLPCF      1 - 70
NGRVVSWLVSAEGSHPDPAPFCADNPSELPPPMERTGGIGDSRPPSFHPHAGGGSQENLDNDTETDSLVS     71 - 140
AQRERPRRRDGPEHATRLNGTAKGERRREPGGYDSSSTLMSSELETTSFFDSDEDDSTSRFSSSTEQSSA    141 - 210
SRLMRRHKRRRRKQKVSRIERSSSFSSITDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGS    211 - 280
IMKGGAVAADGRIEPGDMLLQVNEINFENMSNDDAVRVLREIVHKPGPITLTVAKCWDPSPRGCFTLPRS    281 - 350
EPIRPIDPAAWVSHTAAMTGTFPAYGMSPSLSTITSTSSSITSSIPDTERLDDFHLSIHSDMAAIVKAMA    351 - 420
SPESGLEVRDRMWLKITIPNAFIGSDVVDWLYHNVEGFTDRREARKYASNLLKAGFIRHTVNKITFSEQC    421 - 490
YYIFGDLCGNMANLSLHDHDGSSGASDQDTLAPLPHPGAAPWPMAFPYQYPPPPHPYNPHPGFPELGYSY    491 - 560
GGGSASSQHSEGSRSSGSNRSGSDRRKEKDPKAGDSKSGGSGSESDHTTRSSLRGPRERAPSERSGPAAS    561 - 630
EHSHRSHHSLASSLRSHHTHPSYGPPGVPPLYGPPMLMMPPPPAAMGPPGAPPGRDLASVPPELTASRQS    631 - 700
FRMAMGNPSEFFVDVM                                                          701 - 716
//

Text Mined References (57)

PMID Year Title
27008544 2016 ALFY-Controlled DVL3 Autophagy Regulates Wnt Signaling, Determining Human Brain Size.
26924530 2016 DVL3 Alleles Resulting in a -1 Frameshift of the Last Exon Mediate Autosomal-Dominant Robinow Syndrome.
26359454 2015 Cytosolic TMEM88 promotes invasion and metastasis in lung cancer cells by binding DVLS.
26008736 2016 Gene expression in major depressive disorder.
25847080 2015 miR-204-5p promotes the adipogenic differentiation of human adipose-derived mesenchymal stem cells by modulating DVL3 expression and suppressing Wnt/?-catenin signaling.
25805136 2015 FOXKs promote Wnt/?-catenin signaling by translocating DVL into the nucleus.
25557784 2015 DCDC2 mutations cause a renal-hepatic ciliopathy by disrupting Wnt signaling.
25416956 2014 A proteome-scale map of the human interactome network.
25168481 2014 Dsh homolog DVL3 mediates resistance to IGFIR inhibition by regulating IGF-RAS signaling.
25156800 2015 Dishevelled-3 activates p65 to upregulate p120-catenin transcription via a p38-dependent pathway in non-small cell lung cancer.
More...