Property Summary

NCBI Gene PubMed Count 56
PubMed Score 31.20
PubTator Score 28.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Robinow Syndrome, Autosomal Dominant 3 0.0 0.0
Disease Target Count
Robinow syndrome 11
Disease Target Count P-value
non-small cell lung cancer 2890 1.5e-15
medulloblastoma 720 1.1e-08
glioblastoma 5792 4.6e-05
ovarian cancer 8520 1.0e-04
astrocytoma 1146 2.4e-03
lung cancer 4740 2.7e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytoma 2.200 2.4e-03
glioblastoma 1.100 4.6e-05
lung cancer 1.100 2.7e-03
medulloblastoma 1.100 1.1e-08
non-small cell lung cancer 1.223 1.5e-15
ovarian cancer 1.800 1.0e-04

 GWAS Trait (1)

Gene RIF (24)

AA Sequence

MGETKIIYHLDGQETPYLVKLPLPAERVTLADFKGVLQRPSYKFFFKSMDDDFGVVKEEISDDNAKLPCF      1 - 70
NGRVVSWLVSAEGSHPDPAPFCADNPSELPPPMERTGGIGDSRPPSFHPHAGGGSQENLDNDTETDSLVS     71 - 140
AQRERPRRRDGPEHATRLNGTAKGERRREPGGYDSSSTLMSSELETTSFFDSDEDDSTSRFSSSTEQSSA    141 - 210
SRLMRRHKRRRRKQKVSRIERSSSFSSITDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGS    211 - 280
IMKGGAVAADGRIEPGDMLLQVNEINFENMSNDDAVRVLREIVHKPGPITLTVAKCWDPSPRGCFTLPRS    281 - 350
EPIRPIDPAAWVSHTAAMTGTFPAYGMSPSLSTITSTSSSITSSIPDTERLDDFHLSIHSDMAAIVKAMA    351 - 420
SPESGLEVRDRMWLKITIPNAFIGSDVVDWLYHNVEGFTDRREARKYASNLLKAGFIRHTVNKITFSEQC    421 - 490
YYIFGDLCGNMANLSLHDHDGSSGASDQDTLAPLPHPGAAPWPMAFPYQYPPPPHPYNPHPGFPELGYSY    491 - 560
GGGSASSQHSEGSRSSGSNRSGSDRRKEKDPKAGDSKSGGSGSESDHTTRSSLRGPRERAPSERSGPAAS    561 - 630
EHSHRSHHSLASSLRSHHTHPSYGPPGVPPLYGPPMLMMPPPPAAMGPPGAPPGRDLASVPPELTASRQS    631 - 700
FRMAMGNPSEFFVDVM                                                          701 - 716
//

Text Mined References (65)

PMID Year Title