Property Summary

Ligand Count 1
NCBI Gene PubMed Count 25
PubMed Score 10.52
PubTator Score 8.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Arsenic Poisoning 62 0.0 0.0
Skin Diseases 71 0.0 0.0
Disease Target Count
Dermatologic disorders 93
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Disease Target Count Z-score Confidence
Embryonal testis carcinoma 5 4.036 2.0

Expression

  Differential Expression (8)

Disease log2 FC p
adrenocortical carcinoma -1.145 2.0e-04
atypical teratoid / rhabdoid tumor 1.500 1.2e-05
glioblastoma 1.100 4.9e-03
group 4 medulloblastoma 1.100 1.6e-03
medulloblastoma, large-cell 1.900 2.9e-04
osteosarcoma 3.323 1.0e-08
ovarian cancer -1.600 1.3e-09
pituitary cancer -1.900 8.9e-07

 GO Component (2)

Gene RIF (10)

AA Sequence

MQRRGALFGMPGGSGGRKMAAGDIGELLVPHMPTIRVPRSGDRVYKNECAFSYDSPNSEGGLYVCMNTFL      1 - 70
AFGREHVERHFRKTGQSVYMHLKRHVREKVRGASGGALPKRRNSKIFLDLDTDDDLNSDDYEYEDEAKLV     71 - 140
IFPDHYEIALPNIEELPALVTIACDAVLSSKSPYRKQDPDTWENELPVSKYANNLTQLDNGVRIPPSGWK    141 - 210
CARCDLRENLWLNLTDGSVLCGKWFFDSSGGNGHALEHYRDMGYPLAVKLGTITPDGADVYSFQEEEPVL    211 - 280
DPHLAKHLAHFGIDMLHMHGTENGLQDNDIKLRVSEWEVIQESGTKLKPMYGPGYTGLKNLGNSCYLSSV    281 - 350
MQAIFSIPEFQRAYVGNLPRIFDYSPLDPTQDFNTQMTKLGHGLLSGQYSKPPVKSELIEQVMKEEHKPQ    351 - 420
QNGISPRMFKAFVSKSHPEFSSNRQQDAQEFFLHLVNLVERNRIGSENPSDVFRFLVEERIQCCQTRKVR    421 - 490
YTERVDYLMQLPVAMEAATNKDELIAYELTRREAEANRRPLPELVRAKIPFSACLQAFSEPENVDDFWSS    491 - 560
ALQAKSAGVKTSRFASFPEYLVVQIKKFTFGLDWVPKKFDVSIDMPDLLDINHLRARGLQPGEEELPDIS    561 - 630
PPIVIPDDSKDRLMNQLIDPSDIDESSVMQLAEMGFPLEACRKAVYFTGNMGAEVAFNWIIVHMEEPDFA    631 - 700
EPLTMPGYGGAASAGASVFGASGLDNQPPEEIVAIITSMGFQRNQAIQALRATNNNLERALDWIFSHPEF    701 - 770
EEDSDFVIEMENNANANIISEAKPEGPRVKDGSGTYELFAFISHMGTSTMSGHYICHIKKEGRWVIYNDH    771 - 840
KVCASERPPKDLGYMYFYRRIPS                                                   841 - 863
//

Text Mined References (34)

PMID Year Title