Property Summary

NCBI Gene PubMed Count 22
Grant Count 4
Funding $214,020.8
PubMed Score 8.34
PubTator Score 8.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma 3.323 0.000
atypical teratoid / rhabdoid tumor 1.700 0.000
glioblastoma 1.400 0.000
medulloblastoma 1.400 0.000
medulloblastoma, large-cell 2.000 0.000
adrenocortical carcinoma -1.475 0.000
ovarian cancer -1.700 0.000
pituitary cancer -1.900 0.000

Synonym

Accession Q92995 A8K2S3 B4DYF3 D3DNS2 Q96B25
Symbols ISOT3
IsoT-3

Gene

PDB

2L80   2LBC  

Gene RIF (8)

PMID Text
26453058 Down-regulation of USP13 mediates PTEN protein loss and fibroblast phenotypic change, and thereby plays a crucial role in idiopathic pulmonary fibrosis pathogenesis.
24424410 The authors identify USP13 as a gp78-associated deubiquitinase that eliminates ubiquitin conjugates from Ubl4A to maintain the functionality of Bag6.
24270891 USP13 is a tumour-suppressing protein that functions through deubiquitylation and stabilization of PTEN.
23940278 to our knowledge, USP13 is the first deubiquitinating enzymes identified to modulate STAT1 and play a role in the antiviral activity of IFN against DEN-2 replication.
21962518 USP10 mediates the deubiquitination of p53, regulating deubiquitination activity of USP10 and USP13 by Beclin1 provides a mechanism for Beclin1 to control the levels of p53.
21811243 Through deubiquitination, USP13 stabilizes and upregulates MITF protein levels.
21659512 study identifies a new layer of Siah2 regulation mediated by USP13 binding to ubiquitinated Siah2 protein with a concomitant inhibitory effect on its activity under normoxia
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MQRRGALFGMPGGSGGRKMAAGDIGELLVPHMPTIRVPRSGDRVYKNECAFSYDSPNSEGGLYVCMNTFL      1 - 70
AFGREHVERHFRKTGQSVYMHLKRHVREKVRGASGGALPKRRNSKIFLDLDTDDDLNSDDYEYEDEAKLV     71 - 140
IFPDHYEIALPNIEELPALVTIACDAVLSSKSPYRKQDPDTWENELPVSKYANNLTQLDNGVRIPPSGWK    141 - 210
CARCDLRENLWLNLTDGSVLCGKWFFDSSGGNGHALEHYRDMGYPLAVKLGTITPDGADVYSFQEEEPVL    211 - 280
DPHLAKHLAHFGIDMLHMHGTENGLQDNDIKLRVSEWEVIQESGTKLKPMYGPGYTGLKNLGNSCYLSSV    281 - 350
MQAIFSIPEFQRAYVGNLPRIFDYSPLDPTQDFNTQMTKLGHGLLSGQYSKPPVKSELIEQVMKEEHKPQ    351 - 420
QNGISPRMFKAFVSKSHPEFSSNRQQDAQEFFLHLVNLVERNRIGSENPSDVFRFLVEERIQCCQTRKVR    421 - 490
YTERVDYLMQLPVAMEAATNKDELIAYELTRREAEANRRPLPELVRAKIPFSACLQAFSEPENVDDFWSS    491 - 560
ALQAKSAGVKTSRFASFPEYLVVQIKKFTFGLDWVPKKFDVSIDMPDLLDINHLRARGLQPGEEELPDIS    561 - 630
PPIVIPDDSKDRLMNQLIDPSDIDESSVMQLAEMGFPLEACRKAVYFTGNMGAEVAFNWIIVHMEEPDFA    631 - 700
EPLTMPGYGGAASAGASVFGASGLDNQPPEEIVAIITSMGFQRNQAIQALRATNNNLERALDWIFSHPEF    701 - 770
EEDSDFVIEMENNANANIISEAKPEGPRVKDGSGTYELFAFISHMGTSTMSGHYICHIKKEGRWVIYNDH    771 - 840
KVCASERPPKDLGYMYFYRRIPS                                                   841 - 863
//

Text Mined References (30)

PMID Year Title
26453058 2015 Down-regulation of USP13 mediates phenotype transformation of fibroblasts in idiopathic pulmonary fibrosis.
24424410 2014 USP13 antagonizes gp78 to maintain functionality of a chaperone in ER-associated degradation.
24270891 2013 Deubiquitylation and stabilization of PTEN by USP13.
23940278 2013 Ubiquitin-specific protease 13 regulates IFN signaling by stabilizing STAT1.
22216260 2011 Domain analysis reveals that a deubiquitinating enzyme USP13 performs non-activating catalysis for Lys63-linked polyubiquitin.
21962518 2011 Beclin1 controls the levels of p53 by regulating the deubiquitination activity of USP10 and USP13.
21811243 2011 Regulation of MITF stability by the USP13 deubiquitinase.
21659512 2011 USP13 enzyme regulates Siah2 ligase stability and activity via noncatalytic ubiquitin-binding domains.
21571647 2011 Ubiquitin-recognition protein Ufd1 couples the endoplasmic reticulum (ER) stress response to cell cycle control.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...