Property Summary

NCBI Gene PubMed Count 33
Grant Count 55
R01 Count 36
Funding $11,836,947.03
PubMed Score 158.83
PubTator Score 54.82

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q92994 B3KU36 B4DIG5 B7Z2N3 F5H5Z7 F8WA46 Q13223 Q3SYD9 Q5PR24 Q6IQ02 Q96KX3 Q9HCW6 Q9HCW7 Q9HCW8 TFIIIB90
Symbols BRF
CFDS
hBRF
BRF-1
GTF3B
TAF3C
TAF3B2
TF3B90
TAFIII90
TFIIIB90
HEL-S-76p

Gene

PANTHER Protein Class (1)

Gene RIF (17)

PMID Text
25561519 BRF1 mutations that reduce protein activity cause neurodevelopmental anomalies, suggesting that BRF1-mediated Pol III transcription is required for normal cerebellar and cognitive development.
24978456 hnRNP F is a co-factor in a subset of tristetraprolin/BRF1/BRF2-mediated mRNA decay.
21832157 these observations are in favor of a cell- and context-dependent regulation of Tis11b by hypoxia, which then contributes to modulation of angiogenesis.
21106530 Alcohol induces RNA polymerase III-dependent transcription through c-Jun by co-regulating TATA-binding protein (TBP) and Brf1 expression.
21044367 Observational study of gene-disease association. (HuGE Navigator)
20154270 results identify a human Pol III isoform and isoform-specific functions in the regulation of cell growth and transformation
18700021 deregulation of Brf1 and Brf2 expression could be a key mechanism responsible for the observed deregulation of RNA pol III transcription in cancer cells
18326031 MK2-mediated inhibition of BRF1 requires phosphorylation at S54, S92, and S203.
17968325 Brf1 gene was identified in the genome-wide loss-of-function genetic screen as putative tumor suppressor located at 14q32.33.
17877750 the hypo-phosphorylated Rb appeared to be largely sequestered into a complex with Brf1, which resulted in the blockage of Rb function to repress E2F1 transactivation
More...

AA Sequence

MTGRVCRGCGGTDIELDAARGDAVCTACGSVLEDNIIVSEVQFVESSGGGSSAVGQFVSLDGAGKTPTLG      1 - 70
GGFHVNLGKESRAQTLQNGRRHIHHLGNQLQLNQHCLDTAFNFFKMAVSRHLTRGRKMAHVIAACLYLVC     71 - 140
RTEGTPHMLLDLSDLLQVNVYVLGKTFLLLARELCINAPAIDPCLYIPRFAHLLEFGEKNHEVSMTALRL    141 - 210
LQRMKRDWMHTGRRPSGLCGAALLVAARMHDFRRTVKEVISVVKVCESTLRKRLTEFEDTPTSQLTIDEF    211 - 280
MKIDLEEECDPPSYTAGQRKLRMKQLEQVLSKKLEEVEGEISSYQDAIEIELENSRPKAKGGLASLAKDG    281 - 350
STEDTASSLCGEEDTEDEELEAAASHLNKDLYRELLGGAPGSSEAAGSPEWGGRPPALGSLLDPLPTAAS    351 - 420
LGISDSIRECISSQSSDPKDASGDGELDLSGIDDLEIDRYILNESEARVKAELWMRENAEYLREQREKEA    421 - 490
RIAKEKELGIYKEHKPKKSCKRREPIQASTAREAIEKMLEQKKISSKINYSVLRGLSSAGGGSPHREDAQ    491 - 560
PEHSASARKLSRRRTPASRSGADPVTSVGKRLRPLVSTQPAKKVATGEALLPSSPTLGAEPARPQAVLVE    561 - 630
SGPVSYHADEEADEEEPDEEDGEPCVSALQMMGSNDYGCDGDEDDGY                           631 - 677
//

Text Mined References (40)

PMID Year Title
25561519 2015 BRF1 mutations alter RNA polymerase III-dependent transcription and cause neurodevelopmental anomalies.
24978456 2014 hnRNP F complexes with tristetraprolin and stimulates ARE-mRNA decay.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22139419 2011 New gene functions in megakaryopoiesis and platelet formation.
21832157 2011 A novel function of Tis11b/BRF1 as a regulator of Dll4 mRNA 3'-end processing.
21106530 2011 Alcohol induces RNA polymerase III-dependent transcription through c-Jun by co-regulating TATA-binding protein (TBP) and Brf1 expression.
21044367 2010 An integrative method for scoring candidate genes from association studies: application to warfarin dosing.
20154270 2010 Two isoforms of human RNA polymerase III with specific functions in cell growth and transformation.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...