Property Summary

NCBI Gene PubMed Count 184
PubMed Score 194.69
PubTator Score 191.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 2.9e-03
non primary Sjogren syndrome sicca 891 4.7e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Cancer 2499 3.862 1.9
Alzheimer's disease 658 3.163 1.6
Ataxia telangiectasia 34 3.099 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.100 4.7e-02
osteosarcoma -1.065 2.9e-03

Protein-protein Interaction (14)

Gene RIF (137)

AA Sequence

MAEVGEIIEGCRLPVLRRNQDNEDEWPLAEILSVKDISGRKLFYVHYIDFNKRLDEWVTHERLDLKKIQF      1 - 70
PKKEAKTPTKNGLPGSRPGSPEREVPASAQASGKTLPIPVQITLRFNLPKEREAIPGGEPDQPLSSSSCL     71 - 140
QPNHRSTKRKVEVVSPATPVPSETAPASVFPQNGAARRAVAAQPGRKRKSNCLGTDEDSQDSSDGIPSAP    141 - 210
RMTGSLVSDRSHDDIVTRMKNIECIELGRHRLKPWYFSPYPQELTTLPVLYLCEFCLKYGRSLKCLQRHL    211 - 280
TKCDLRHPPGNEIYRKGTISFFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFH    281 - 350
IVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQ    351 - 420
TILEILMGLKSESGERPQITINEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDIVDGHERAMLK    421 - 490
RLLRIDSKCLHFTPKDWSKRGKW                                                   491 - 513
//

Text Mined References (192)

PMID Year Title