Property Summary

NCBI Gene PubMed Count 166
Grant Count 611
R01 Count 414
Funding $60,532,815.88
PubMed Score 178.05
PubTator Score 191.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.065 0.003
non primary Sjogren syndrome sicca 1.100 0.047

Synonym

Accession Q92993 B4E3C7 C9JL99 O95624 Q13430 Q17RW5 Q561W3 Q6GSE8 Q9BWK7
Symbols TIP
ESA1
PLIP
TIP60
cPLA2
HTATIP
ZC2HC5
HTATIP1

Gene

PDB

2EKO   2OU2   4QQG  

Gene RIF (130)

PMID Text
26994140 UV irradiation enhanced the binding of ATF3 to Tip60, knockdown of ATF3 expression decreased Tip60 stability, thereby impairing Tip60 induction by UV irradiation.
26780987 KAT5 is significantly elevated in malignant pleural mesothelioma
26512777 Data suggest the combination of histone acetyltransferase TIP60 and microRNA miR-22 as prognostic indicator of breast cancer progression.
26469385 HIV-1 MA downregulates KAT5 gene expression in HepG2 cells
26464124 We demonstrate for the first time that tumor suppressor Tip60 down-regulates cell adhesion and MT1-MMP expression and thereby invasion of glioblastoma cells
26446986 TIP60 relocalization to the chromatin to acetylates histone H4K16 and prevents the binding of 53BP1 to its docking site.Impaired TIP60-mediated H4K16 acetylation accounts for the aberrant chromatin accumulation of 53BP1 and RAP80 in Fanconi anemia.
26438602 the acetylation-dependent NBS1 turnover by TIP60 on damaged chromatin restricts the dispersal of NBS1 foci from the sites of DNA damage.
26420831 Our results revealed a major role of the KAT5-ATM axis in protection of replicating chromatin against damage by the endogenous carcinogen FA.
26234678 Colony-formation assays and soft agar assays show that gain of function of TIP60 or depletion of EDD1 in HPV-positive cervical cancer cells significantly inhibits cell growth in vitro
25865756 The stress-responsive gene ATF3 regulates the histone acetyltransferase Tip60 stability by promoting USP7-mediated deubiquitination of Tip60.
More...

AA Sequence

MAEVGEIIEGCRLPVLRRNQDNEDEWPLAEILSVKDISGRKLFYVHYIDFNKRLDEWVTHERLDLKKIQF      1 - 70
PKKEAKTPTKNGLPGSRPGSPEREVPASAQASGKTLPIPVQITLRFNLPKEREAIPGGEPDQPLSSSSCL     71 - 140
QPNHRSTKRKVEVVSPATPVPSETAPASVFPQNGAARRAVAAQPGRKRKSNCLGTDEDSQDSSDGIPSAP    141 - 210
RMTGSLVSDRSHDDIVTRMKNIECIELGRHRLKPWYFSPYPQELTTLPVLYLCEFCLKYGRSLKCLQRHL    211 - 280
TKCDLRHPPGNEIYRKGTISFFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFH    281 - 350
IVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQ    351 - 420
TILEILMGLKSESGERPQITINEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDIVDGHERAMLK    421 - 490
RLLRIDSKCLHFTPKDWSKRGKW                                                   491 - 513
//

Text Mined References (174)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26994140 2016 The Stress-responsive Gene ATF3 Mediates Dichotomous UV Responses by Regulating the Tip60 and p53 Proteins.
26780987 2016 KAT5 (Tip60) is a potential therapeutic target in malignant pleural mesothelioma.
26512777 2015 TIP60-miR-22 axis as a prognostic marker of breast cancer progression.
26464124 2016 Tip60 regulates MT1-MMP transcription and invasion of glioblastoma cells through NF-?B pathway.
26446986 2016 Impaired TIP60-mediated H4K16 acetylation accounts for the aberrant chromatin accumulation of 53BP1 and RAP80 in Fanconi anemia pathway-deficient cells.
26438602 2015 Acetylation of Histone H2AX at Lys 5 by the TIP60 Histone Acetyltransferase Complex Is Essential for the Dynamic Binding of NBS1 to Damaged Chromatin.
26420831 2016 ATM and KAT5 safeguard replicating chromatin against formaldehyde damage.
26234678 2016 E3 ligase EDD1/UBR5 is utilized by the HPV E6 oncogene to destabilize tumor suppressor TIP60.
25865756 2015 The stress-responsive gene ATF3 regulates the histone acetyltransferase Tip60.
More...