Property Summary

NCBI Gene PubMed Count 20
Grant Count 8
Funding $396,751.66
PubMed Score 72.99
PubTator Score 21.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
oligodendroglioma -1.100 0.024
astrocytoma -1.100 0.004
glioblastoma -1.100 0.001
lung cancer 1.800 0.003

Gene RIF (8)

PMID Text
24961656 Our report contributes to document the possible association between the c.395-1G>C mutation of GLMN gene and glomuvenous malformations.
22748924 Structural and biochemical analyses reveal that GLMN adopts a HEAT-like repeat fold that tightly binds the E2-interacting surface of RBX1, inhibiting CRL-mediated chain formation by the E2 CDC34.
22678819 FAP48 adipocyte expression plays a key role in HIV-associated lipodystrophy.
22405651 The glomuvenous malformation protein Glomulin binds Rbx1 and regulates cullin-1 RING ligase-mediated turnover of Fbw7.
22280104 These data identify glomulin as a permissivity factor for VACV infection and as a potential therapeutic target for inhibition of vaccinia virus (VACV) infection.
22092580 A novel GLMN mutation is described in an Italian family with glomuvenous malformations in which some members present with the less commonly observed phenotype of solitary lesions.
12604780 FAP48-FKBP complexes increase IL2 production
11845407 Describes the characterizations of 14 different mutations in the glomulin gene in patients with glomuvenous malformations.

AA Sequence

MAVEELQSIIKRCQILEEQDFKEEDFGLFQLAGQRCIEEGHTDQLLEIIQNEKNKVIIKNMGWNLVGPVV      1 - 70
RCLLCKDKEDSKRKVYFLIFDLLVKLCNPKELLLGLLELIEEPSGKQISQSILLLLQPLQTVIQKLHNKA     71 - 140
YSIGLALSTLWNQLSLLPVPYSKEQIQMDDYGLCQCCKALIEFTKPFVEEVIDNKENSLENEKLKDELLK    141 - 210
FCFKSLKCPLLTAQFFEQSEEGGNDPFRYFASEIIGFLSAIGHPFPKMIFNHGRKKRTWNYLEFEEEENK    211 - 280
QLADSMASLAYLVFVQGIHIDQLPMVLSPLYLLQFNMGHIEVFLQRTEESVISKGLELLENSLLRIEDNS    281 - 350
LLYQYLEIKSFLTVPQGLVKVMTLCPIETLRKKSLAMLQLYINKLDSQGKYTLFRCLLNTSNHSGVEAFI    351 - 420
IQNIKNQIDMSLKRTRNNKWFTGPQLISLLDLVLFLPEGAETDLLQNSDRIMASLNLLRYLVIKDNENDN    421 - 490
QTGLWTELGNIENNFLKPLHIGLNMSKAHYEAEIKNSQEAQKSKDLCSITVSGEEIPNMPPEMQLKVLHS    491 - 560
ALFTFDLIESVLARVEELIEIKTKSTSEENIGIK                                        561 - 594
//

Text Mined References (25)

PMID Year Title
24961656 2014 Incomplete penetrance of GLMN gene c.395-1G>C mutation in a family with glomuvenous malformations.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22748924 2012 Structure of a glomulin-RBX1-CUL1 complex: inhibition of a RING E3 ligase through masking of its E2-binding surface.
22678819 2012 Role of FAP48 in HIV-associated lipodystrophy.
22405651 2012 The glomuvenous malformation protein Glomulin binds Rbx1 and regulates cullin RING ligase-mediated turnover of Fbw7.
22280104 2012 Glomulin: a permissivity factor for vaccinia virus infection.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22092580 2011 A novel mutation of the glomulin gene in an Italian family with autosomal dominant cutaneous glomuvenous malformations.
21269460 2011 Initial characterization of the human central proteome.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
More...