Property Summary

NCBI Gene PubMed Count 44
Grant Count 23
R01 Count 15
Funding $3,346,970.33
PubMed Score 52.69
PubTator Score 55.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 2.700 0.000
psoriasis -2.300 0.001
medulloblastoma, large-cell 1.800 0.039
lung cancer 3.400 0.000

Gene RIF (29)

PMID Text
26524685 indicate that gains of DLX4 and ERBB2 occur in South African breast cancer patients irrespectively of their race and factors known to influence prognosis
26208636 Collectively, our findings indicate that DLX4 exerts opposing effects on the megakaryocytic and erythroid lineages in part by inducing IL-1beta and NF-kappaB signaling.
26067154 DLX4 induces CD44 by stimulating IL-1beta-mediated NF-kappaB activity, thereby promoting peritoneal metastasis of ovarian cancer
25954033 This first finding of a DLX4 mutation in a family with Cleft lip and/or palate establishes DLX4 as a potential cause of human clefts
25924901 DLX4 promotes ovarian tumor angiogenesis in part by stimulating iNOS expression.
25825198 Methylated DLX4 is a potential biomarker that predicts poor prognosis after curative resection of pathologic stage I Non-Small Cell Lung Cancer.
25823567 a DLX4 overexpression vector lacking the 3'UTR was shown to abolish miR-122-induced inhibition of proliferation in the HCC cell line Hep3B.
25614457 Aberrant DNA methylation of the DLX4 and SIM1 genes may be a novel progression marker for uterine cervical low-grade squamous intraepithelial lesions.
25471527 DLX4 can functionally replace c-MYC.
24947980 DLX4 increased copy number was observed in 21.6% of the primary breast tumors and 24.3% of the sentinel lymph node metastasis
More...

AA Sequence

MTSLPCPLPGRDASKAVFPDLAPVPSVAAAYPLGLSPTTAASPNLSYSRPYGHLLSYPYTEPANPGDSYL      1 - 70
SCQQPAALSQPLCGPAEHPQELEADSEKPRLSPEPSERRPQAPAKKLRKPRTIYSSLQLQHLNQRFQHTQ     71 - 140
YLALPERAQLAAQLGLTQTQVKIWFQNKRSKYKKLLKQNSGGQEGDFPGRTFSVSPCSPPLPSLWDLPKA    141 - 210
GTLPTSGYGNSFGAWYQHHSSDVLASPQMM                                            211 - 240
//

Text Mined References (44)

PMID Year Title
26524685 2015 Copy Number Analysis of the DLX4 and ERBB2 Genes in South African Breast Cancer Patients.
26208636 2015 The homeobox gene DLX4 regulates erythro-megakaryocytic differentiation by stimulating IL-1? and NF-?B signaling.
26067154 2015 The homeoprotein DLX4 stimulates NF-?B activation and CD44-mediated tumor-mesothelial cell interactions in ovarian cancer.
25954033 2015 DLX4 is associated with orofacial clefting and abnormal jaw development.
25924901 2015 The homeoprotein DLX4 controls inducible nitric oxide synthase-mediated angiogenesis in ovarian cancer.
25825198 2015 Methylated DLX4 Predicts Response to Pathologic Stage I Non-Small Cell Lung Cancer Resection.
25823567 2015 Regulation of the oncogenic function of distal-less 4 by microRNA-122 in hepatocellular carcinoma.
25614457 2015 Aberrant DNA methylation of DLX4 and SIM1 is a predictive marker for disease progression of uterine cervical low-grade squamous intraepithelial lesion.
25471527 2014 The homeobox gene DLX4 promotes generation of human induced pluripotent stem cells.
24947980 2014 Increased copy number of the DLX4 homeobox gene in breast axillary lymph node metastasis.
More...