Property Summary

NCBI Gene PubMed Count 46
PubMed Score 53.79
PubTator Score 55.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Neoplasm Invasiveness 161 0.0 0.0
OROFACIAL CLEFT 15 1 0.0 0.0
Disease Target Count
Cleft palate with cleft lip 23
Disease Target Count P-value
malignant mesothelioma 3232 8.4e-08
lung cancer 4740 3.3e-05
psoriasis 6694 9.9e-04
medulloblastoma, large-cell 6241 3.9e-02

Expression

  Differential Expression (4)

Disease log2 FC p
lung cancer 3.400 3.3e-05
malignant mesothelioma 2.700 8.4e-08
medulloblastoma, large-cell 1.800 3.9e-02
psoriasis -2.300 9.9e-04

Gene RIF (31)

AA Sequence

MTSLPCPLPGRDASKAVFPDLAPVPSVAAAYPLGLSPTTAASPNLSYSRPYGHLLSYPYTEPANPGDSYL      1 - 70
SCQQPAALSQPLCGPAEHPQELEADSEKPRLSPEPSERRPQAPAKKLRKPRTIYSSLQLQHLNQRFQHTQ     71 - 140
YLALPERAQLAAQLGLTQTQVKIWFQNKRSKYKKLLKQNSGGQEGDFPGRTFSVSPCSPPLPSLWDLPKA    141 - 210
GTLPTSGYGNSFGAWYQHHSSDVLASPQMM                                            211 - 240
//

Text Mined References (46)

PMID Year Title