Property Summary

NCBI Gene PubMed Count 123
PubMed Score 287.47
PubTator Score 209.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
acute quadriplegic myopathy 1.582 7.5e-06
Amyotrophic lateral sclerosis 1.085 1.1e-05
Atopic dermatitis 1.900 2.1e-05
Breast cancer 1.400 1.8e-07
breast carcinoma 1.200 1.9e-22
cutaneous lupus erythematosus 3.000 3.0e-04
cystic fibrosis 1.300 3.5e-03
dermatomyositis 1.300 3.1e-02
ductal carcinoma in situ 1.300 4.9e-04
glioblastoma multiforme 1.300 3.1e-16
interstitial cystitis 1.800 1.7e-03
intraductal papillary-mucinous neoplasm ... 2.400 5.2e-04
invasive ductal carcinoma 1.600 5.6e-04
juvenile dermatomyositis 3.131 2.6e-17
lung adenocarcinoma 2.000 1.5e-10
malignant mesothelioma 1.700 4.2e-06
Multiple Sclerosis 1.600 3.6e-02
ovarian cancer 1.800 1.8e-04
pancreatic cancer 1.200 9.0e-04
pituitary cancer -1.600 1.2e-05
psoriasis 2.300 1.7e-08
subependymal giant cell astrocytoma 1.388 1.5e-02
Systemic lupus erythematosus 1.200 4.2e-04

Protein-protein Interaction (1)

Gene RIF (103)

AA Sequence

MALAPERAAPRVLFGEWLLGEISSGCYEGLQWLDEARTCFRVPWKHFARKDLSEADARIFKAWAVARGRW      1 - 70
PPSSRGGGPPPEAETAERAGWKTNFRCALRSTRRFVMLRDNSGDPADPHKVYALSRELCWREGPGTDQTE     71 - 140
AEAPAAVPPPQGGPPGPFLAHTHAGLQAPGPLPAPAGDKGDLLLQAVQQSCLADHLLTASWGADPVPTKA    141 - 210
PGEGQEGLPLTGACAGGPGLPAGELYGWAVETTPSPGPQPAALTTGEAAAPESPHQAEPYLSPSPSACTA    211 - 280
VQEPSPGALDVTIMYKGRTVLQKVVGHPSCTFLYGPPDPAVRATDPQQVAFPSPAELPDQKQLRYTEELL    281 - 350
RHVAPGLHLELRGPQLWARRMGKCKVYWEVGGPPGSASPSTPACLLPRNCDTPIFDFRVFFQELVEFRAR    351 - 420
QRRGSPRYTIYLGFGQDLSAGRPKEKSLVLVKLEPWLCRVHLEGTQREGVSSLDSSSLSLCLSSANSLYD    421 - 490
DIECFLMELEQPA                                                             491 - 503
//

Text Mined References (133)

PMID Year Title