Property Summary

NCBI Gene PubMed Count 114
Grant Count 201
R01 Count 123
Funding $16,627,289.26
PubMed Score 263.80
PubTator Score 209.48

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q92985 B9EGL3 O00331 O00332 O00333 O75924 Q9UE79 IRF-7
Symbols IMD39
IRF7A
IRF7B
IRF7C
IRF7H
IRF-7H

Gene

PDB

2O61  

Gene RIF (99)

PMID Text
26761402 Human IRF7 was shown to be essential for interferon type I-dependent protective immunity against primary influenza. (Review)
26608321 IRF7 cleavage by the 3C protease of enterovirus D68 abrogated its capacity to activate type I interferon expression and limit virus replication.
26597380 Interferon regulatory factor 7 (IRF7) is a direct target of miR-762 and overexpression of miR-762 reduced expression of IRF7.
26005050 Data indicate that the type-I interferon master regulator gene interferon regulatory factor 7 (IRF7) is only hypomethylated in lupus patients with renal involvement.
25911105 The interaction between AIP and IRF7 is enhanced upon virus infection, and AIP potently inhibits IRF7-induced type I IFN (IFN-alpha/beta) production.
25835418 The IRF7 GG genotype associate with Cognitive Decline and Dementia.
25814066 These findings suggest that IRF7-dependent amplification of type I and III IFNs is required for protection against primary infection by influenza virus in humans.
25680411 our results indicate that IRF7 promotes glioma cell invasion and both chemoresistance and radioresistance through AGO2 inhibition
25520509 Authors conclude that paramyxoviruses trigger the DNA damage response, a pathway required for MSK1 activation of phospho Ser 276 RelA formation to trigger the IRF7-RIG-I amplification loop necessary for mucosal interferon production.
25476905 In TSC2-deficient angiomyolipoma patient cells, IRF7 is a pivotal factor in the Rheb/mTOR pathway.
More...

AA Sequence

MALAPERAAPRVLFGEWLLGEISSGCYEGLQWLDEARTCFRVPWKHFARKDLSEADARIFKAWAVARGRW      1 - 70
PPSSRGGGPPPEAETAERAGWKTNFRCALRSTRRFVMLRDNSGDPADPHKVYALSRELCWREGPGTDQTE     71 - 140
AEAPAAVPPPQGGPPGPFLAHTHAGLQAPGPLPAPAGDKGDLLLQAVQQSCLADHLLTASWGADPVPTKA    141 - 210
PGEGQEGLPLTGACAGGPGLPAGELYGWAVETTPSPGPQPAALTTGEAAAPESPHQAEPYLSPSPSACTA    211 - 280
VQEPSPGALDVTIMYKGRTVLQKVVGHPSCTFLYGPPDPAVRATDPQQVAFPSPAELPDQKQLRYTEELL    281 - 350
RHVAPGLHLELRGPQLWARRMGKCKVYWEVGGPPGSASPSTPACLLPRNCDTPIFDFRVFFQELVEFRAR    351 - 420
QRRGSPRYTIYLGFGQDLSAGRPKEKSLVLVKLEPWLCRVHLEGTQREGVSSLDSSSLSLCLSSANSLYD    421 - 490
DIECFLMELEQPA                                                             491 - 503
//

Text Mined References (124)

PMID Year Title
26761402 2016 Host genetics of severe influenza: from mouse Mx1 to human IRF7.
26608321 2015 3C Protease of Enterovirus D68 Inhibits Cellular Defense Mediated by Interferon Regulatory Factor 7.
26597380 2015 microRNA-762 promotes breast cancer cell proliferation and invasion by targeting IRF7 expression.
26005050 2015 Renal involvement in lupus is characterized by unique DNA methylation changes in naïve CD4+ T cells.
25911105 2015 Aryl Hydrocarbon Receptor Interacting Protein Targets IRF7 to Suppress Antiviral Signaling and the Induction of Type I Interferon.
25835418 2015 Variants in Antiviral Genes are Risk Factors for Cognitive Decline and Dementia.
25814066 2015 Infectious disease. Life-threatening influenza and impaired interferon amplification in human IRF7 deficiency.
25680411 2015 IRF7 promotes glioma cell invasion by inhibiting AGO2 expression.
25520509 2015 Ataxia telangiectasia mutated kinase mediates NF-?B serine 276 phosphorylation and interferon expression via the IRF7-RIG-I amplification loop in paramyxovirus infection.
25476905 2014 Analysis of gene expression array in TSC2-deficient AML cells reveals IRF7 as a pivotal factor in the Rheb/mTOR pathway.
More...