Property Summary

NCBI Gene PubMed Count 21
Grant Count 3
Funding $374,067
PubMed Score 51.99
PubTator Score 27.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
gastric cancer -1.100 0.002
astrocytoma 1.200 0.003
glioblastoma 1.300 0.004
medulloblastoma, large-cell -1.200 0.002
tuberculosis -1.300 0.002
subependymal giant cell astrocytoma 1.945 0.023
mucosa-associated lymphoid tissue lympho... 1.402 0.044

Gene RIF (12)

PMID Text
25860173 Ninj1 modulates TLR4 signaling, which itself plays a major role in systemic inflammatory response syndrome and sepsis.
25766274 Ninj1 expression was detected in both HSMCs and HUVECs, and was higher in the former. Ninj1 expression was enhanced by hypoxia in HUVECs.
22326538 The NINJ1 gene polymorphism plays an important role in nerve degeneration in leprosy patients.
22162058 Data show an important cell-specific role for Ninjurin-1 in the transmigration of inflammatory APCs across the BBB.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18504448 Observational study of gene-disease association. (HuGE Navigator)
17893696 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MDSGTEEYELNGGLPPGTPGSPDASPARWGWRHGPINVNHYASKKSAAESMLDIALLMANASQLKAVVEQ      1 - 70
GPSFAFYVPLVVLISISLVLQIGVGVLLIFLVKYDLNNPAKHAKLDFLNNLATGLVFIIVVVNIFITAFG     71 - 140
VQKPLMDMAPQQ                                                              141 - 152
//

Text Mined References (22)

PMID Year Title
25860173 2015 Contribution of Ninjurin1 to Toll-like receptor 4 signaling and systemic inflammation.
25766274 2015 Ninjurin1 is a novel factor to regulate angiogenesis through the function of pericytes.
25416956 2014 A proteome-scale map of the human interactome network.
23563609 2013 Genome-wide SNP and CNV analysis identifies common and low-frequency variants associated with severe early-onset obesity.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22326538 2012 NINJURIN1 single nucleotide polymorphism and nerve damage in leprosy.
22162058 2011 Role of Ninjurin-1 in the migration of myeloid cells to central nervous system inflammatory lesions.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
More...