Property Summary

NCBI Gene PubMed Count 19
PubMed Score 0.00
PubTator Score 46.51

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 1.800 0.000
osteosarcoma -1.401 0.000

Synonym

Accession Q92979 O00675 O00726
Symbols C2F
NEP1
Grcc2f

Gene

PDB

5FAI  

Gene RIF (3)

PMID Text
22174317 HIV-1 Rev interacting protein, EMG1 nucleolar protein homolog (EMG1), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with EMG1 is increased by RRE
19463982 Mutation of a gene essential for ribosome biogenesis, EMG1, causes Bowen-Conradi syndrome.
18950845 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAAPSDGFKPRERSGGEQAQDWDALPPKRPRLGAGNKIGGRRLIVVLEGASLETVKVGKTYELLNCDKHK      1 - 70
SILLKNGRDPGEARPDITHQSLLMLMDSPLNRAGLLQVYIHTQKNVLIEVNPQTRIPRTFDRFCGLMVQL     71 - 140
LHKLSVRAADGPQKLLKVIKNPVSDHFPVGCMKVGTSFSIPVVSDVRELVPSSDPIVFVVGAFAHGKVSV    141 - 210
EYTEKMVSISNYPLSAALTCAKLTTAFEEVWGVI                                        211 - 244
//

Text Mined References (20)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
20047967 2010 The ribosome assembly factor Nep1 responsible for Bowen-Conradi syndrome is a pseudouridine-N1-specific methyltransferase.
19463982 2009 Mutation of a gene essential for ribosome biogenesis, EMG1, causes Bowen-Conradi syndrome.
18950845 2009 Evaluating new candidate SNPs as low penetrance risk factors in sporadic breast cancer: a two-stage Spanish case-control study.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15590835 2004 The small-subunit processome is a ribosome assembly intermediate.
More...