Property Summary

NCBI Gene PubMed Count 20
PubMed Score 0.00
PubTator Score 46.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 1.800 4.9e-07
osteosarcoma -1.401 6.5e-06

Gene RIF (4)

AA Sequence

MAAPSDGFKPRERSGGEQAQDWDALPPKRPRLGAGNKIGGRRLIVVLEGASLETVKVGKTYELLNCDKHK      1 - 70
SILLKNGRDPGEARPDITHQSLLMLMDSPLNRAGLLQVYIHTQKNVLIEVNPQTRIPRTFDRFCGLMVQL     71 - 140
LHKLSVRAADGPQKLLKVIKNPVSDHFPVGCMKVGTSFSIPVVSDVRELVPSSDPIVFVVGAFAHGKVSV    141 - 210
EYTEKMVSISNYPLSAALTCAKLTTAFEEVWGVI                                        211 - 244
//

Text Mined References (23)

PMID Year Title