Property Summary

NCBI Gene PubMed Count 68
Grant Count 73
R01 Count 38
Funding $8,063,391.97
PubMed Score 47.40
PubTator Score 189.28

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q92974 D3DVA6 O75142 Q15079 Q5VY92 Q8TDA3 Q8WUG4 Q9H023
Symbols GEF
P40
GEFH1
LFP40
GEF-H1

Gene

PDB

5EFX  

Gene RIF (37)

PMID Text
26866809 regulation of c-Src trafficking requires both microtubules and actin polymerization, and GEF-H1 coordinates c-Src trafficking, acting as a molecular switch between these two mechanisms
26820534 this study reports the crystal structure of human GEF-H1 PH domain to 2.45 A resolution.
26759237 By stimulating cofilin/PP2A-mediated dephosphorylation of the guanine nucleotide exchange factor GEF-H1.
26359301 data suggest that the induction of SGK1 through treatment with dexamethasone alters MT dynamics to increase Sec5-GEF-H1 interactions, which promote GEF-H1 targeting to adhesion sites.
25687035 Results supported that miR-512-3p could inhibit tumor cell adhesion, migration, and invasion by regulating the RAC1 activity via DOCK3 in NSCLC A549 and H1299 cell lines.
25143398 TGF-beta regulates LARG and GEF-H1 during epithelial-mesenchymal transition to affect stiffening response to force and cell invasion.
24706358 Paxillin-GEF-H1-p42/44-MAPK module as a regulator of pathological mechanotransduction.
24525234 The RhoGEF GEF-H1 is required for oncogenic RAS signaling via KSR-1.
24352660 This study investigated a novel mechanism of vascular barrier protection by ANP via modulation of GEF-H1 function.
24043311 ERK binds to the Rho exchange factor GEF-H1 and phosphorylates it on S959, causing inhibition of GEF-H1 activity and a consequent decrease in RhoA activity.
More...

AA Sequence

MSRIESLTRARIDRSRELASKTREKEKMKEAKDARYTNGHLFTTISVSGMTMCYACNKSITAKEALICPT      1 - 70
CNVTIHNRCKDTLANCTKVKQKQQKAALLKNNTALQSVSLRSKTTIRERPSSAIYPSDSFRQSLLGSRRG     71 - 140
RSSLSLAKSVSTTNIAGHFNDESPLGLRRILSQSTDSLNMRNRTLSVESLIDEAEVIYSELMSDFEMDEK    141 - 210
DFAADSWSLAVDSSFLQQHKKEVMKQQDVIYELIQTELHHVRTLKIMTRLFRTGMLEELHLEPGVVQGLF    211 - 280
PCVDELSDIHTRFLSQLLERRRQALCPGSTRNFVIHRLGDLLISQFSGPSAEQMCKTYSEFCSRHSKALK    281 - 350
LYKELYARDKRFQQFIRKVTRPAVLKRHGVQECILLVTQRITKYPLLISRILQHSHGIEEERQDLTTALG    351 - 420
LVKELLSNVDEGIYQLEKGARLQEIYNRMDPRAQTPVPGKGPFGREELLRRKLIHDGCLLWKTATGRFKD    421 - 490
VLVLLMTDVLVFLQEKDQKYIFPTLDKPSVVSLQNLIVRDIANQEKGMFLISAAPPEMYEVHTASRDDRS    491 - 560
TWIRVIQQSVRTCPSREDFPLIETEDEAYLRRIKMELQQKDRALVELLREKVGLFAEMTHFQAEEDGGSG    561 - 630
MALPTLPRGLFRSESLESPRGERLLQDAIREVEGLKDLLVGPGVELLLTPREPALPLEPDSGGNTSPGVT    631 - 700
ANGEARTFNGSIELCRADSDSSQRDRNGNQLRSPQEEALQRLVNLYGLLHGLQAAVAQQDTLMEARFPEG    701 - 770
PERREKLCRANSRDGEAGRAGAAPVAPEKQATELALLQRQHALLQEELRRCRRLGEERATEAGSLEARLR    771 - 840
ESEQARALLEREAEEARRQLAALGQTEPLPAEAPWARRPVDPRRRSLPAGDALYLSFNPPQPSRGTDRLD    841 - 910
LPVTTRSVHRNFEDRERQELGSPEERLQDSSDPDTGSEEEGSSRLSPPHSPRDFTRMQDIPEETESRDGE    911 - 980
AVASES                                                                    981 - 986
//

Text Mined References (87)

PMID Year Title
26866809 2016 Microtubule and Actin Interplay Drive Intracellular c-Src Trafficking.
26820534 2016 Crystal structure of hGEF-H1 PH domain provides insight into incapability in phosphoinositide binding.
26759237 2016 RASSF1A Suppresses the Invasion and Metastatic Potential of Human Non-Small Cell Lung Cancer Cells by Inhibiting YAP Activation through the GEF-H1/RhoB Pathway.
26359301 2015 Dexamethasone-induced cellular tension requires a SGK1-stimulated Sec5-GEF-H1 interaction.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25687035 2015 Inhibition of RAC1-GEF DOCK3 by miR-512-3p contributes to suppression of metastasis in non-small cell lung cancer.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25416956 2014 A proteome-scale map of the human interactome network.
25143398 2014 TGF-? regulates LARG and GEF-H1 during EMT to affect stiffening response to force and cell invasion.
24706358 2014 Paxillin mediates stretch-induced Rho signaling and endothelial permeability via assembly of paxillin-p42/44MAPK-GEF-H1 complex.
More...