Property Summary

NCBI Gene PubMed Count 33
Grant Count 4
Funding $179,537.33
PubMed Score 35.12
PubTator Score 23.64

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q92968 B2RCS1
Symbols ZWS
NALD
PBD11A
PBD11B

Gene

Gene RIF (4)

PMID Text
23716570 Results show PEX13 interacts with itself in peroxisomes in living cells and the import of PTS1 (peroxisomal targeting signal 1) proteins is specifically disrupted when homooligomerization of PEX13 is interrupted.
19449432 Zellweger syndrome caused by PEX13 deficiency: report of two novel mutations.
16006427 analysis of PEX13 substitution of Ile326 by threonine in a patient with peroxisomal biogenesis disorder [case report]
14715663 Pex13p has a role in determining the peroxisomal localization of Pex14p

AA Sequence

MASQPPPPPKPWETRRIPGAGPGPGPGPTFQSADLGPTLMTRPGQPALTRVPPPILPRPSQQTGSSSVNT      1 - 70
FRPAYSSFSSGYGAYGNSFYGGYSPYSYGYNGLGYNRLRVDDLPPSRFVQQAEESSRGAFQSIESIVHAF     71 - 140
ASVSMMMDATFSAVYNSFRAVLDVANHFSRLKIHFTKVFSAFALVRTIRYLYRRLQRMLGLRRGSENEDL    141 - 210
WAESEGTVACLGAEDRAATSAKSWPIFLFFAVILGGPYLIWKLLSTHSDEVTDSINWASGEDDHVVARAE    211 - 280
YDFAAVSEEEISFRAGDMLNLALKEQQPKVRGWLLASLDGQTTGLIPANYVKILGKRKGRKTVESSKVSK    281 - 350
QQQSFTNPTLTKGATVADSLDEQEAAFESVFVETNKVPVAPDSIGKDGEKQDL                     351 - 403
//

Text Mined References (32)

PMID Year Title
23716570 2013 Functional analysis of PEX13 mutation in a Zellweger syndrome spectrum patient reveals novel homooligomerization of PEX13 and its role in human peroxisome biogenesis.
22412388 2012 A genome-wide scan of Ashkenazi Jewish Crohn's disease suggests novel susceptibility loci.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21525035 2011 PEX14 is required for microtubule-based peroxisome motility in human cells.
20531392 2010 The peroxisomal receptor Pex19p forms a helical mPTS recognition domain.
19946888 2010 Defining the membrane proteome of NK cells.
19449432 2009 Zellweger syndrome caused by PEX13 deficiency: report of two novel mutations.
17881773 2007 Peroxisomes in human and mouse testis: differential expression of peroxisomal proteins in germ cells and distinct somatic cell types of the testis.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
More...