Property Summary

NCBI Gene PubMed Count 13
PubMed Score 8.03
PubTator Score 7.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.100 1.7e-04
astrocytic glioma -1.100 1.4e-02
atypical teratoid / rhabdoid tumor -1.400 4.4e-06
ependymoma 1.300 1.6e-02
glioblastoma -1.700 9.2e-04
group 4 medulloblastoma 1.100 4.6e-04
hepatocellular carcinoma 1.100 1.4e-04
lung cancer 1.400 8.0e-03
malignant mesothelioma -1.300 1.7e-05
medulloblastoma, large-cell -1.600 2.8e-06
osteosarcoma -1.180 4.2e-05
ovarian cancer 1.300 1.1e-04
Pick disease 1.200 2.0e-04
psoriasis -1.900 1.2e-04

Gene RIF (1)

AA Sequence

MAEGSRGGPTCSGVGGRQDPVSGSGGCNFPEYELPELNTRAFHVGAFGELWRGRLRGAGDLSLREPPASA      1 - 70
LPGSQAADSDREDAAVARDLDCSLEAAAELRAVCGLDKLKCLEDGEDPEVIPENTDLVTLGVRKRFLEHR     71 - 140
EETITIDRACRQETFVYEMESHAIGKKPENSADMIEEGELILSVNILYPVIFHKHKEHKPYQTMLVLGSQ    141 - 210
KLTQLRDSIRCVSDLQIGGEFSNTPDQAPEHISKDLYKSAFFYFEGTFYNDKRYPECRDLSRTIIEWSES    211 - 280
HDRGYGKFQTARMEDFTFNDLCIKLGFPYLYCHQGDCEHVIVITDIRLVHHDDCLDRTLYPLLIKKHWLW    281 - 350
TRKCFVCKMYTARWVTNNDSFAPEDPCFFCDVCFRMLHYDSEGNKLGEFLAYPYVDPGTFN             351 - 411
//

Text Mined References (14)

PMID Year Title