Property Summary

NCBI Gene PubMed Count 13
Grant Count 5
R01 Count 5
Funding $985,568
PubMed Score 8.03
PubTator Score 7.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
hepatocellular carcinoma 1.100 0.000
malignant mesothelioma -1.600 0.000
astrocytic glioma -1.100 0.014
ependymoma 1.300 0.016
psoriasis -1.900 0.000
osteosarcoma 1.940 0.000
atypical teratoid / rhabdoid tumor -1.400 0.000
glioblastoma -1.700 0.001
medulloblastoma, large-cell -1.600 0.000
lung cancer 1.400 0.008
pediatric high grade glioma -1.400 0.000
group 4 medulloblastoma 1.100 0.000
Pick disease 1.200 0.000
ovarian cancer 1.300 0.000

Gene RIF (1)

PMID Text
16901896 SNAP50 zinc finger domain contributes to cooperative promoter recognition by human SNAPC

AA Sequence

MAEGSRGGPTCSGVGGRQDPVSGSGGCNFPEYELPELNTRAFHVGAFGELWRGRLRGAGDLSLREPPASA      1 - 70
LPGSQAADSDREDAAVARDLDCSLEAAAELRAVCGLDKLKCLEDGEDPEVIPENTDLVTLGVRKRFLEHR     71 - 140
EETITIDRACRQETFVYEMESHAIGKKPENSADMIEEGELILSVNILYPVIFHKHKEHKPYQTMLVLGSQ    141 - 210
KLTQLRDSIRCVSDLQIGGEFSNTPDQAPEHISKDLYKSAFFYFEGTFYNDKRYPECRDLSRTIIEWSES    211 - 280
HDRGYGKFQTARMEDFTFNDLCIKLGFPYLYCHQGDCEHVIVITDIRLVHHDDCLDRTLYPLLIKKHWLW    281 - 350
TRKCFVCKMYTARWVTNNDSFAPEDPCFFCDVCFRMLHYDSEGNKLGEFLAYPYVDPGTFN             351 - 411
//

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
16901896 2006 The unorthodox SNAP50 zinc finger domain contributes to cooperative promoter recognition by human SNAPC.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
12621023 2003 The small nuclear RNA-activating protein 190 Myb DNA binding domain stimulates TATA box-binding protein-TATA box recognition.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11094070 2000 The retinoblastoma tumor suppressor protein targets distinct general transcription factors to regulate RNA polymerase III gene expression.
11056176 2001 A map of protein-protein contacts within the small nuclear RNA-activating protein complex SNAPc.
More...