Property Summary

NCBI Gene PubMed Count 106
PubMed Score 282.86
PubTator Score 160.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell -1.200 2.0e-04
osteosarcoma -1.410 3.9e-04
pancreatic ductal adenocarcinoma liver m... 1.210 1.3e-02

 CSPA Cell Line (1)

Gene RIF (77)

AA Sequence

MEPPGDWGPPPWRSTPKTDVLRLVLYLTFLGAPCYAPALPSCKEDEYPVGSECCPKCSPGYRVKEACGEL      1 - 70
TGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRA     71 - 140
YATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKCSWLVTKAGAGTSSSHWVWWFLSGSL    141 - 210
VIVIVCSTVGLIICVKRRKPRGDVVKVIVSVQRKRQEAEGEATVIEALQAPPDVTTVAVEETIPSFTGRS    211 - 280
PNH                                                                       281 - 283
//

Text Mined References (109)

PMID Year Title