Property Summary

NCBI Gene PubMed Count 95
Grant Count 256
R01 Count 123
Funding $24,618,798.1
PubMed Score 264.59
PubTator Score 160.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.410 0.000
medulloblastoma, large-cell -1.200 0.000
pancreatic ductal adenocarcinoma liver m... 1.210 0.013

Synonym

Accession Q92956 B3KW30 B9DI89 Q6IB95 Q8N634 Q8WXR1 Q96J31 Q9UM65
Symbols TR2
ATAR
HVEA
HVEM
CD270
LIGHTR

Gene

PDB

4RSU   1JMA   2AW2   4FHQ  

Gene RIF (66)

PMID Text
26650888 In eight cases (42%) we observed recurrent copy number loss of chr1:2,352,236-4,574,271, a region containing the candidate tumor suppressor TNFRSF14.
26202493 Study report the crystal structure of unbound HVEM, which further contributes to the understanding of the molecular mechanisms controlling recognition between HVEM and its ligands.
25750286 HVEM may play a critical role in tumor progression and immune evasion
25468715 Data indicate that tumour-expressing herpes virus entry mediator (HVEMplays a critical role in hepatocellular carcinoma (HCC), suggesting targeting HVEM may be a promising therapeutic strategy for HCC.
24980868 Relative expression of HVEM and LTbetaR modulates canonical NF-kappaB and pro-apoptotic signals stimulated by LIGHT.
24314649 The conformation of the N-terminus of herpes simplex virus gD is induced by direct binding to HVEM and nectin-1.
24249528 HVEM plays a critical role in both tumor progression and the evasion of host antitumor immune responses, possibly through direct and indirect mechanisms.
24162774 HIV-1 gp120 upregulates the expression of tumor necrosis factor receptor superfamily, member 14 (TNFRSF14) in human B cells
23976978 HVEM gene polymorphisms are associated with sporadic breast cancer in Chinese women.
23761635 HVEM functions as a regulator of immune function that activates NK cells via CD160 and limits lymphocyte-induced inflammation via association with B and T lymphocyte attenuator
More...

AA Sequence

MEPPGDWGPPPWRSTPKTDVLRLVLYLTFLGAPCYAPALPSCKEDEYPVGSECCPKCSPGYRVKEACGEL      1 - 70
TGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRA     71 - 140
YATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKCSWLVTKAGAGTSSSHWVWWFLSGSL    141 - 210
VIVIVCSTVGLIICVKRRKPRGDVVKVIVSVQRKRQEAEGEATVIEALQAPPDVTTVAVEETIPSFTGRS    211 - 280
PNH                                                                       281 - 283
//

Text Mined References (98)

PMID Year Title
26977880 2016 Facilitating T Cell Infiltration in Tumor Microenvironment Overcomes Resistance to PD-L1 Blockade.
26650888 2016 Recurrent somatic loss of TNFRSF14 in classical Hodgkin lymphoma.
26202493 2015 Increased Heterologous Protein Expression in Drosophila S2 Cells for Massive Production of Immune Ligands/Receptors and Structural Analysis of Human HVEM.
25750286 2015 HVEM expression contributes to tumor progression and prognosis in human colorectal cancer.
25468715 2015 Clinical impact of herpesvirus entry mediator expression in human hepatocellular carcinoma.
24980868 2014 Herpesvirus entry mediator (HVEM) attenuates signals mediated by the lymphotoxin ? receptor (LT?R) in human cells stimulated by the shared ligand LIGHT.
24449572 2014 Novel rheumatoid arthritis susceptibility locus at 22q12 identified in an extended UK genome-wide association study.
24314649 2014 Induction of conformational changes at the N-terminus of herpes simplex virus glycoprotein D upon binding to HVEM and nectin-1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24249528 2014 Significant involvement of herpesvirus entry mediator in human esophageal squamous cell carcinoma.
More...