Property Summary

NCBI Gene PubMed Count 54
Grant Count 142
R01 Count 86
Funding $47,188,274.54
PubMed Score 475.02
PubTator Score 252.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma -1.110 0.038
pancreatic ductal adenocarcinoma liver m... -1.506 0.001
lung cancer 2.300 0.000
lung adenocarcinoma -3.900 0.000
lung carcinoma -2.900 0.000
non-small cell lung carcinoma -1.500 0.000
mucosa-associated lymphoid tissue lympho... 2.430 0.016
ductal carcinoma in situ -1.700 0.013
ovarian cancer -5.800 0.000

Synonym

Accession Q92954 Q6DNC4 Q6DNC5 Q6ZMZ5 Q9BX49
Symbols MSF
SZP
CACP
HAPO
JCAP

Gene

PANTHER Protein Class (2)

Gene RIF (35)

PMID Text
26867127 Cartilage derived from MSCs expressed lubricin protein both in vitro and in vivo
26643105 PRG4 binds to TLR2 and TLR4 and this binding mediates a novel anti-inflammatory role for PRG4.
26037740 no synovial fluid level differences detected between healthy knees and injured knees
25818000 The finding that rhPRG4 can increase the viscosity of low concentration HA solutions suggests that supplementation with rhPRG4 may help mitigate the loss in synovial fluid viscosity experienced with decreased HA concentration in osteoarthritis.
25708025 PRG4 is a novel putative ligand for CD44 and may control synoviocyte overgrowth in inflammatory arthropathies via a CD44-mediated mechanism.
25187573 The O-glycomap of lubricin, a novel mucin responsible for joint lubrication, has been identified by site-specific glycopeptide analysis.
25172828 Lubricin (Prg4) plays a role in preventing damage to the superficial zone and preservation of chondrocytes. [Review]
24406099 We speculate that an important role of lubricin in mediating interactions at the cartilage surface is to attach to the cartilage surface and provide a protective coating that maintains the contacting surfaces in a sterically repulsive state.
23756439 5 novel PRG4 mutations and the first case of CACP syndrome resulting from uniparental disomy of chromosome 1.
23599181 Lubricin is transcribed, translated, and expressed by ocular surface epithelia. Lubricin presence significantly reduces friction between the cornea and conjunctiva.
More...

AA Sequence

MAWKTLPIYLLLLLSVFVIQQVSSQDLSSCAGRCGEGYSRDATCNCDYNCQHYMECCPDFKRVCTAELSC      1 - 70
KGRCFESFERGRECDCDAQCKKYDKCCPDYESFCAEVHNPTSPPSSKKAPPPSGASQTIKSTTKRSPKPP     71 - 140
NKKKTKKVIESEEITEEHSVSENQESSSSSSSSSSSSTIRKIKSSKNSAANRELQKKLKVKDNKKNRTKK    141 - 210
KPTPKPPVVDEAGSGLDNGDFKVTTPDTSTTQHNKVSTSPKITTAKPINPRPSLPPNSDTSKETSLTVNK    211 - 280
ETTVETKETTTTNKQTSTDGKEKTTSAKETQSIEKTSAKDLAPTSKVLAKPTPKAETTTKGPALTTPKEP    281 - 350
TPTTPKEPASTTPKEPTPTTIKSAPTTPKEPAPTTTKSAPTTPKEPAPTTTKEPAPTTPKEPAPTTTKEP    351 - 420
APTTTKSAPTTPKEPAPTTPKKPAPTTPKEPAPTTPKEPTPTTPKEPAPTTKEPAPTTPKEPAPTAPKKP    421 - 490
APTTPKEPAPTTPKEPAPTTTKEPSPTTPKEPAPTTTKSAPTTTKEPAPTTTKSAPTTPKEPSPTTTKEP    491 - 560
APTTPKEPAPTTPKKPAPTTPKEPAPTTPKEPAPTTTKKPAPTTPKEPAPTTPKETAPTTPKKLTPTTPE    561 - 630
KLAPTTPEKPAPTTPEELAPTTPEEPTPTTPEEPAPTTPKAAAPNTPKEPAPTTPKEPAPTTPKEPAPTT    631 - 700
PKETAPTTPKGTAPTTLKEPAPTTPKKPAPKELAPTTTKEPTSTTCDKPAPTTPKGTAPTTPKEPAPTTP    701 - 770
KEPAPTTPKGTAPTTLKEPAPTTPKKPAPKELAPTTTKGPTSTTSDKPAPTTPKETAPTTPKEPAPTTPK    771 - 840
KPAPTTPETPPPTTSEVSTPTTTKEPTTIHKSPDESTPELSAEPTPKALENSPKEPGVPTTKTPAATKPE    841 - 910
MTTTAKDKTTERDLRTTPETTTAAPKMTKETATTTEKTTESKITATTTQVTSTTTQDTTPFKITTLKTTT    911 - 980
LAPKVTTTKKTITTTEIMNKPEETAKPKDRATNSKATTPKPQKPTKAPKKPTSTKKPKTMPRVRKPKTTP    981 - 1050
TPRKMTSTMPELNPTSRIAEAMLQTTTRPNQTPNSKLVEVNPKSEDAGGAEGETPHMLLRPHVFMPEVTP   1051 - 1120
DMDYLPRVPNQGIIINPMLSDETNICNGKPVDGLTTLRNGTLVAFRGHYFWMLSPFSPPSPARRITEVWG   1121 - 1190
IPSPIDTVFTRCNCEGKTFFFKDSQYWRFTNDIKDAGYPKPIFKGFGGLTGQIVAALSTAKYKNWPESVY   1191 - 1260
FFKRGGSIQQYIYKQEPVQKCPGRRPALNYPVYGETTQVRRRRFERAIGPSQTHTIRIQYSPARLAYQDK   1261 - 1330
GVLHNEVKVSILWRGLPNVVTSAISLPNIRKPDGYDYYAFSKDQYYNIDVPSRTARAITTRSGQTLSKVW   1331 - 1400
YNCP                                                                     1401 - 1404
//

Text Mined References (56)

PMID Year Title
26867127 2016 Cartilage Derived from Bone Marrow Mesenchymal Stem Cells Expresses Lubricin In Vitro and In Vivo.
26643105 2015 The interaction of lubricin/proteoglycan 4 (PRG4) with toll-like receptors 2 and 4: an anti-inflammatory role of PRG4 in synovial fluid.
26037740 2015 Does intra-articular fracture change the lubricant content of synovial fluid?
25818000 2014 Effects of concentration and structure on proteoglycan 4 rheology and interaction with hyaluronan.
25708025 2015 Lubricin/Proteoglycan 4 Binding to CD44 Receptor: A Mechanism of the Suppression of Proinflammatory Cytokine-Induced Synoviocyte Proliferation by Lubricin.
25307495 2014 Biosynthesis of collagen I, II, RUNX2 and lubricin at different time points of chondrogenic differentiation in a 3D in vitro model of human mesenchymal stem cells derived from adipose tissue.
25187573 2014 The O-glycomap of lubricin, a novel mucin responsible for joint lubrication, identified by site-specific glycopeptide analysis.
25172828 2014 The biology of lubricin: near frictionless joint motion.
24997456 2014 Characterization of full-length recombinant human Proteoglycan 4 as an ocular surface boundary lubricant.
24932985 2014 Lubricin expression in human osteoarthritic knee meniscus and synovial fluid: a morphological, immunohistochemical and biochemical study.
More...