Property Summary

Ligand Count 4
NCBI Gene PubMed Count 16
PubMed Score 20.09
PubTator Score 11.58

Knowledge Summary

Patent (1,801)

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.300 3.3e-03
astrocytic glioma -1.100 2.0e-02
Astrocytoma, Pilocytic -1.600 2.0e-06
atypical teratoid / rhabdoid tumor -1.300 2.6e-04
ependymoma -1.100 6.1e-03
glioblastoma -1.400 2.7e-07
group 3 medulloblastoma 2.900 5.3e-05
lung carcinoma 2.100 2.1e-15
medulloblastoma, large-cell 1.100 6.0e-03
ovarian cancer 1.200 3.2e-09

Gene RIF (7)

AA Sequence

MAEKAPPGLNRKTSRSTLSLPPEPVDIIRSKTCSRRVKINVGGLNHEVLWRTLDRLPRTRLGKLRDCNTH      1 - 70
ESLLEVCDDYNLNENEYFFDRHPGAFTSILNFYRTGKLHMMEEMCALSFGQELDYWGIDEIYLESCCQAR     71 - 140
YHQKKEQMNEELRREAETMREREGEEFDNTCCPDKRKKLWDLLEKPNSSVAAKILAIVSILFIVLSTIAL    141 - 210
SLNTLPELQETDEFGQLNDNRQLAHVEAVCIAWFTMEYLLRFLSSPNKWKFFKGPLNVIDLLAILPYYVT    211 - 280
IFLTESNKSVLQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFS    281 - 350
SLVFFAEKDEDATKFTSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNF    351 - 420
SEFYKEQKRQEKAIKRREALERAKRNGSIVSMNLKDAFARSMELIDVAVEKAGESANTKDSADDNHLSPS    421 - 490
RWKWARKALSETSSNKSFENKYQEVSQKDSHEQLNNTSSSSPQHLSAQKLEMLYNEITKTQPHSHPNPDC    491 - 560
QEKPERPSAYEEEIEMEEVVCPQEQLAVAQTEVIVDMKSTSSIDSFTSCATDFTETERSPLPPPSASHLQ    561 - 630
MKFPTDLPGTEEHQRARGPPFLTLSREKGPAARDGTLEYAPVDITVNLDASGSQCGLHSPLQSDNATDSP    631 - 700
KSSLKGSNPLKSRSLKVNFKENRGSAPQTPPSTARPLPVTTADFSLTTPQHISTILLEETPSQGDRPLLG    701 - 770
TEVSAPCQGPSKGLSPRFPKQKLFPFSSRERRSFTEIDTGDDEDFLELPGAREEKQVDSSPNCFADKPSD    771 - 840
GRDPLREEGSVGSSSPQDTGHNCRQDIYHAVSEVKKDSSQEGCKMENHLFAPEIHSNPGDTGYCPTRETS    841 - 910
M//

Text Mined References (18)

PMID Year Title