Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.00
PubTator Score 28.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ependymoma 2514 1.90206687685691E-13
glioblastoma 5572 2.61881987628812E-8
osteosarcoma 7933 3.14249925595503E-7
atypical teratoid / rhabdoid tumor 4369 1.10760766375452E-6
pilocytic astrocytoma 3086 1.08753040348651E-5
pediatric high grade glioma 2712 2.35477446979741E-5
psoriasis 6685 1.14184683527701E-4
sonic hedgehog group medulloblastoma 1482 7.47463076695118E-4
primitive neuroectodermal tumor 3031 0.0352388766466648

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis 1.800 0.000
osteosarcoma 2.019 0.000
ependymoma -1.500 0.000
glioblastoma -1.400 0.000
atypical teratoid / rhabdoid tumor -1.300 0.000
sonic hedgehog group medulloblastoma -1.300 0.001
primitive neuroectodermal tumor -1.100 0.035
pediatric high grade glioma -1.300 0.000
pilocytic astrocytoma -1.300 0.000

Synonym

Accession Q92952 Q5KR10 Q6DJU4 SK1
Symbols SK1
hSK1
SKCA1
KCa2.1

Gene

  Ortholog (7)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
C. elegans OMA Inparanoid
Fruitfly OMA Inparanoid

Gene RIF (5)

PMID Text
24434522 Differentiated dopaminergic neurons expressed low levels of SK2 channels and high levels of SK1 and SK3 channels.
22154908 Decreased expression of small-conductance Ca2+-activated K+ channels SK1 and SK2 in human chronic atrial fibrillation.
22082156 Knockdown of potassium intermediate/small conductance calcium-activated channel, subfamily N, member 1 (KCNN1) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
12598727 IK1-like immunoreactivity is observed in enteric neurons of human colon, with a significant decrease of IK1-positive cells in inflamed colon from patients with Crohn's disease and ulcerative colitis.
10758170 HIV-1 gp120 from both CCR5- and CXCR4-tropic HIV-1 strains opens calcium-activated potassium (K(Ca)), chloride, and calcium-permeant nonselective cation channels in macrophages; these signals are mediated by CCR5 and CXCR4

AA Sequence

MNSHSYNGSVGRPLGSGPGALGRDPPDPEAGHPPQPPHSPGLQVVVAKSEPARPSPGSPRGQPQDQDDDE      1 - 70
DDEEDEAGRQRASGKPSNVGHRLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETELSWGVYTKESLYSF     71 - 140
ALKCLISLSTAILLGLVVLYHAREIQLFMVDNGADDWRIAMTCERVFLISLELAVCAIHPVPGHYRFTWT    141 - 210
ARLAFTYAPSVAEADVDVLLSIPMFLRLYLLGRVMLLHSKIFTDASSRSIGALNKITFNTRFVMKTLMTI    211 - 280
CPGTVLLVFSISSWIIAAWTVRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLT    281 - 350
GIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKHTRLVKKPDQARV    351 - 420
RKHQRKFLQAIHQAQKLRSVKIEQGKLNDQANTLTDLAKTQTVMYDLVSELHAQHEELEARLATLESRLD    421 - 490
ALGASLQALPGLIAQAIRPPPPPLPPRPGPGPQDQAARSSPCRWTPVAPSDCG                     491 - 543
//

Text Mined References (13)

PMID Year Title
24434522 2014 Subcellular expression and neuroprotective effects of SK channels in human dopaminergic neurons.
22154908 2012 Decreased expression of small-conductance Ca2+-activated K+ channels SK1 and SK2 in human chronic atrial fibrillation.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
16382103 2005 International Union of Pharmacology. LII. Nomenclature and molecular relationships of calcium-activated potassium channels.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12598727 2003 Decreased potassium channel IK1 and its regulator neurotrophin-3 (NT-3) in inflamed human bowel.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11844726 2002 Calcium-activated potassium channel SK1- and IK1-like immunoreactivity in injured human sensory neurones and its regulation by neurotrophic factors.
11258935 2001 Calmodulin binding to the C-terminus of the small-conductance Ca2+-activated K+ channel hSK1 is affected by alternative splicing.
11146124 2000 Quantitative expression analysis of the small conductance calcium-activated potassium channels, SK1, SK2 and SK3, in human brain.
More...