Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.00
PubTator Score 28.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis 1.800 0.000
osteosarcoma 2.019 0.000
ependymoma -1.500 0.000
glioblastoma -1.400 0.000
atypical teratoid / rhabdoid tumor -1.300 0.000
sonic hedgehog group medulloblastoma -1.300 0.001
primitive neuroectodermal tumor -1.100 0.035
pediatric high grade glioma -1.300 0.000
pilocytic astrocytoma -1.300 0.000

Gene RIF (5)

PMID Text
24434522 Differentiated dopaminergic neurons expressed low levels of SK2 channels and high levels of SK1 and SK3 channels.
22154908 Decreased expression of small-conductance Ca2+-activated K+ channels SK1 and SK2 in human chronic atrial fibrillation.
22082156 Knockdown of potassium intermediate/small conductance calcium-activated channel, subfamily N, member 1 (KCNN1) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
12598727 IK1-like immunoreactivity is observed in enteric neurons of human colon, with a significant decrease of IK1-positive cells in inflamed colon from patients with Crohn's disease and ulcerative colitis.
10758170 HIV-1 gp120 from both CCR5- and CXCR4-tropic HIV-1 strains opens calcium-activated potassium (K(Ca)), chloride, and calcium-permeant nonselective cation channels in macrophages; these signals are mediated by CCR5 and CXCR4

AA Sequence

MNSHSYNGSVGRPLGSGPGALGRDPPDPEAGHPPQPPHSPGLQVVVAKSEPARPSPGSPRGQPQDQDDDE      1 - 70
DDEEDEAGRQRASGKPSNVGHRLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETELSWGVYTKESLYSF     71 - 140
ALKCLISLSTAILLGLVVLYHAREIQLFMVDNGADDWRIAMTCERVFLISLELAVCAIHPVPGHYRFTWT    141 - 210
ARLAFTYAPSVAEADVDVLLSIPMFLRLYLLGRVMLLHSKIFTDASSRSIGALNKITFNTRFVMKTLMTI    211 - 280
CPGTVLLVFSISSWIIAAWTVRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLT    281 - 350
GIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKHTRLVKKPDQARV    351 - 420
RKHQRKFLQAIHQAQKLRSVKIEQGKLNDQANTLTDLAKTQTVMYDLVSELHAQHEELEARLATLESRLD    421 - 490
ALGASLQALPGLIAQAIRPPPPPLPPRPGPGPQDQAARSSPCRWTPVAPSDCG                     491 - 543
//

Text Mined References (13)

PMID Year Title
24434522 2014 Subcellular expression and neuroprotective effects of SK channels in human dopaminergic neurons.
22154908 2012 Decreased expression of small-conductance Ca2+-activated K+ channels SK1 and SK2 in human chronic atrial fibrillation.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
16382103 2005 International Union of Pharmacology. LII. Nomenclature and molecular relationships of calcium-activated potassium channels.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12598727 2003 Decreased potassium channel IK1 and its regulator neurotrophin-3 (NT-3) in inflamed human bowel.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11844726 2002 Calcium-activated potassium channel SK1- and IK1-like immunoreactivity in injured human sensory neurones and its regulation by neurotrophic factors.
11258935 2001 Calmodulin binding to the C-terminus of the small-conductance Ca2+-activated K+ channel hSK1 is affected by alternative splicing.
11146124 2000 Quantitative expression analysis of the small conductance calcium-activated potassium channels, SK1, SK2 and SK3, in human brain.
More...