Property Summary

NCBI Gene PubMed Count 51
PubMed Score 327.85
PubTator Score 186.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Glutaric Acidemia I 1 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 3.9e-07
pancreatic ductal adenocarcinoma liver metastasis 1962 4.8e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Amino acid metabolic disorder 5 0.0 4.0

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -2.273 3.9e-07
pancreatic ductal adenocarcinoma liver m... -1.124 4.8e-02

Protein-protein Interaction (2)

Gene RIF (25)

AA Sequence

MALRGVSVRLLSRGPGLHVLRTWVSSAAQTEKGGRTQSQLAKSSRPEFDWQDPLVLEEQLTTDEILIRDT      1 - 70
FRTYCQERLMPRILLANRNEVFHREIISEMGELGVLGPTIKGYGCAGVSSVAYGLLARELERVDSGYRSA     71 - 140
MSVQSSLVMHPIYAYGSEEQRQKYLPQLAKGELLGCFGLTEPNSGSDPSSMETRAHYNSSNKSYTLNGTK    141 - 210
TWITNSPMADLFVVWARCEDGCIRGFLLEKGMRGLSAPRIQGKFSLRASATGMIIMDGVEVPEENVLPGA    211 - 280
SSLGGPFGCLNNARYGIAWGVLGASEFCLHTARQYALDRMQFGVPLARNQLIQKKLADMLTEITLGLHAC    281 - 350
LQLGRLKDQDKAAPEMVSLLKRNNCGKALDIARQARDMLGGNGISDEYHVIRHAMNLEAVNTYEGTHDIH    351 - 420
ALILGRAITGIQAFTASK                                                        421 - 438
//

Text Mined References (57)

PMID Year Title