Property Summary

NCBI Gene PubMed Count 48
PubMed Score 84.42
PubTator Score 61.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Small cell carcinoma of lung 45
Disease Target Count P-value
glioblastoma 5572 3.6328817389551E-7
ovarian cancer 8492 1.06806472300732E-6
psoriasis 6685 5.97022324858181E-6
atypical teratoid / rhabdoid tumor 4369 8.07175509370405E-6
medulloblastoma, large-cell 6234 4.42259243634102E-5
astrocytoma 1493 2.85002590638285E-4
osteosarcoma 7933 0.0130003218022367
Disease Target Count Z-score Confidence
Poliomyelitis 11 4.956 2.5

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis -3.400 0.000
osteosarcoma -1.511 0.013
astrocytoma 2.200 0.000
atypical teratoid / rhabdoid tumor 1.100 0.000
glioblastoma 1.500 0.000
medulloblastoma, large-cell 1.300 0.000
ovarian cancer 2.000 0.000

Synonym

Accession Q92945 O00301 Q59EZ9 Q5U4P6 Q9UNT5 Q9UQH5 FUSE-binding protein 2
Symbols FBP2
KSRP
FUBP2

Gene

PDB

2HH2   2HH3   2JVZ   2OPU   2OPV   4B8T  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid

Gene RIF (28)

PMID Text
25993413 Khsrp as a highly regulated RBP in response to genotoxic stress.
25910425 Functional analysis of selected regulated proteins revealed that knockdown of HNRPD, PHB2 and UB2V2 can increase HCMV replication, while knockdown of A4 and KSRP resulted in decreased HCMV replication.
24845017 The ability of KSRP to integrate different levels of gene expression is required for proper immune response. [Review]
24023901 subcellular localization of KSRP is regulated by competing interactions with DDX1 or 14-3-3
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of KH-type splicing regulatory protein (KHSRP, FUBP2) expression by HIV-1 Vpr in Vpr transduced macrophages
23524258 KSRP induces enhanced processing of pri- and pre-miR-155 in cystic fibrosis lung epithelial cells.
23345520 Enterovirus 71 infection cleaved FBP2, which altered its function when its carboxyl terminus was cleaved.
23142982 Binding of the human KSRP protein to let-7 miRNA precursors positively regulates their processing to mature let-7, thereby contributing to control of cell proliferation, apoptosis and differentiation
23125841 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of KH-type splicing regulatory protein (KHSRP, FUBP2) expression by HIV-1 Vpr in Vpr transduced macrophages
21935887 The role of KSRP in mRNA decay and microRNA precursor maturation.
More...

AA Sequence

MSDYSTGGPPPGPPPPAGGGGGAGGAGGGPPPGPPGAGDRGGGGPGGGGPGGGSAGGPSQPPGGGGPGIR      1 - 70
KDAFADAVQRARQIAAKIGGDAATTVNNSTPDFGFGGQKRQLEDGDQPESKKLASQGDSISSQLGPIHPP     71 - 140
PRTSMTEEYRVPDGMVGLIIGRGGEQINKIQQDSGCKVQISPDSGGLPERSVSLTGAPESVQKAKMMLDD    141 - 210
IVSRGRGGPPGQFHDNANGGQNGTVQEIMIPAGKAGLVIGKGGETIKQLQERAGVKMILIQDGSQNTNVD    211 - 280
KPLRIIGDPYKVQQACEMVMDILRERDQGGFGDRNEYGSRIGGGIDVPVPRHSVGVVIGRSGEMIKKIQN    281 - 350
DAGVRIQFKQDDGTGPEKIAHIMGPPDRCEHAARIINDLLQSLRSGPPGPPGGPGMPPGGRGRGRGQGNW    351 - 420
GPPGGEMTFSIPTHKCGLVIGRGGENVKAINQQTGAFVEISRQLPPNGDPNFKLFIIRGSPQQIDHAKQL    421 - 490
IEEKIEGPLCPVGPGPGGPGPAGPMGPFNPGPFNQGPPGAPPHAGGPPPHQYPPQGWGNTYPQWQPPAPH    491 - 560
DPSKAAAAAADPNAAWAAYYSHYYQQPPGPVPGPAPAPAAPPAQGEPPQPPPTGQSDYTKAWEEYYKKIG    561 - 630
QQPQQPGAPPQQDYTKAWEEYYKKQAQVATGGGPGAPPGSQPDYSAAWAEYYRQQAAYYGQTPGPGGPQP    631 - 700
PPTQQGQQQAQ                                                               701 - 711
//

Text Mined References (67)

PMID Year Title
25993413 2015 Label-Free Protein-RNA Interactome Analysis Identifies Khsrp Signaling Downstream of the p38/Mk2 Kinase Complex as a Critical Modulator of Cell Cycle Progression.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25910425 2015 Subcellular quantitative proteomic analysis reveals host proteins involved in human cytomegalovirus infection.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24845017 2014 KSRP controls pleiotropic cellular functions.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24023901 2013 DEAD box protein DDX1 regulates cytoplasmic localization of KSRP.
23524258 2013 Regulation of miR-155 biogenesis in cystic fibrosis lung epithelial cells: antagonistic role of two mRNA-destabilizing proteins, KSRP and TTP.
23345520 2013 Enterovirus 71 infection cleaves a negative regulator for viral internal ribosomal entry site-driven translation.
More...