Property Summary

NCBI Gene PubMed Count 58
PubMed Score 93.04
PubTator Score 61.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Small Cell Lung Carcinoma 41 0.0 0.0
Disease Target Count
Small cell carcinoma of lung 45
Disease Target Count P-value
glioblastoma 5792 3.6e-07
ovarian cancer 8520 1.1e-06
osteosarcoma 7950 6.5e-06
atypical teratoid / rhabdoid tumor 5112 8.1e-06
psoriasis 6694 1.7e-05
medulloblastoma, large-cell 6241 4.4e-05
astrocytoma 1146 2.9e-04
Disease Target Count Z-score Confidence
Poliomyelitis 14 4.95 2.5

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytoma 2.200 2.9e-04
atypical teratoid / rhabdoid tumor 1.100 8.1e-06
glioblastoma 1.500 3.6e-07
medulloblastoma, large-cell 1.300 4.4e-05
osteosarcoma 1.163 6.5e-06
ovarian cancer 2.000 1.1e-06
psoriasis -3.000 1.7e-05

Gene RIF (37)

AA Sequence

MSDYSTGGPPPGPPPPAGGGGGAGGAGGGPPPGPPGAGDRGGGGPGGGGPGGGSAGGPSQPPGGGGPGIR      1 - 70
KDAFADAVQRARQIAAKIGGDAATTVNNSTPDFGFGGQKRQLEDGDQPESKKLASQGDSISSQLGPIHPP     71 - 140
PRTSMTEEYRVPDGMVGLIIGRGGEQINKIQQDSGCKVQISPDSGGLPERSVSLTGAPESVQKAKMMLDD    141 - 210
IVSRGRGGPPGQFHDNANGGQNGTVQEIMIPAGKAGLVIGKGGETIKQLQERAGVKMILIQDGSQNTNVD    211 - 280
KPLRIIGDPYKVQQACEMVMDILRERDQGGFGDRNEYGSRIGGGIDVPVPRHSVGVVIGRSGEMIKKIQN    281 - 350
DAGVRIQFKQDDGTGPEKIAHIMGPPDRCEHAARIINDLLQSLRSGPPGPPGGPGMPPGGRGRGRGQGNW    351 - 420
GPPGGEMTFSIPTHKCGLVIGRGGENVKAINQQTGAFVEISRQLPPNGDPNFKLFIIRGSPQQIDHAKQL    421 - 490
IEEKIEGPLCPVGPGPGGPGPAGPMGPFNPGPFNQGPPGAPPHAGGPPPHQYPPQGWGNTYPQWQPPAPH    491 - 560
DPSKAAAAAADPNAAWAAYYSHYYQQPPGPVPGPAPAPAAPPAQGEPPQPPPTGQSDYTKAWEEYYKKIG    561 - 630
QQPQQPGAPPQQDYTKAWEEYYKKQAQVATGGGPGAPPGSQPDYSAAWAEYYRQQAAYYGQTPGPGGPQP    631 - 700
PPTQQGQQQAQ                                                               701 - 711
//

Text Mined References (79)

PMID Year Title