Property Summary

NCBI Gene PubMed Count 11
PubMed Score 19.84
PubTator Score 9.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Synonym

Accession Q92935 Q6GSC1
Symbols EXTL

Gene

PANTHER Protein Class (2)

AA Sequence

MQSWRRRKSLWLALSASWLLLVLLGGFSLLRLALPPRPRPGASQGWPRWLDAELLQSFSQPGELPEDAVS      1 - 70
PPQAPHGGSCNWESCFDTSKCRGDGLKVFVYPAVGTISETHRRILASIEGSRFYTFSPAGACLLLLLSLD     71 - 140
AQTGECSSMPLQWNRGRNHLVLRLHPAPCPRTFQLGQAMVAEASPTVDSFRPGFDVALPFLPEAHPLRGG    141 - 210
APGQLRQHSPQPGVALLALEEERGGWRTADTGSSACPWDGRCEQDPGPGQTQRQETLPNATFCLISGHRP    211 - 280
EAASRFLQALQAGCIPVLLSPRWELPFSEVIDWTKAAIVADERLPLQVLAALQEMSPARVLALRQQTQFL    281 - 350
WDAYFSSVEKVIHTTLEVIQDRIFGTSAHPSLLWNSPPGALLALSTFSTSPQDFPFYYLQQGSRPEGRFS    351 - 420
ALIWVGPPGQPPLKLIQAVAGSQHCAQILVLWSNERPLPSRWPETAVPLTVIDGHRKVSDRFYPYSTIRT    421 - 490
DAILSLDARSSLSTSEVDFAFLVWQSFPERMVGFLTSSHFWDEAHGGWGYTAERTNEFSMVLTTAAFYHR    491 - 560
YYHTLFTHSLPKALRTLADEAPTCVDVLMNFIVAAVTKLPPIKVPYGKQRQEAAPLAPGGPGPRPKPPAP    561 - 630
APDCINQIAAAFGHMPLLSSRLRLDPVLFKDPVSVQRKKYRSLEKP                            631 - 676
//

Text Mined References (11)

PMID Year Title
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15110891 2004 Molecular analysis of the putative tumour-suppressor gene EXTL1 in neuroblastoma patients and cell lines.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12417417 2002 Hereditary multiple exostoses and heparan sulfate polymerization.
11390981 2001 Human tumor suppressor EXT gene family members EXTL1 and EXTL3 encode alpha 1,4- N-acetylglucosaminyltransferases that likely are involved in heparan sulfate/ heparin biosynthesis.
10575224 1999 Refined physical mapping and genomic structure of the EXTL1 gene.
10480354 Mutation analysis of hereditary multiple exostoses in the Chinese.
More...