Property Summary

NCBI Gene PubMed Count 11
PubMed Score 19.86
PubTator Score 9.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.300 4.0e-03
atypical teratoid / rhabdoid tumor -2.000 1.6e-08
ependymoma -1.300 2.9e-09
glioblastoma -1.200 8.6e-05
group 3 medulloblastoma -1.200 2.9e-02
medulloblastoma, large-cell -1.900 1.4e-03
non-inflammatory breast cancer -1.300 1.0e-04
primitive neuroectodermal tumor -2.000 1.4e-04
psoriasis -1.900 1.8e-35

AA Sequence

MQSWRRRKSLWLALSASWLLLVLLGGFSLLRLALPPRPRPGASQGWPRWLDAELLQSFSQPGELPEDAVS      1 - 70
PPQAPHGGSCNWESCFDTSKCRGDGLKVFVYPAVGTISETHRRILASIEGSRFYTFSPAGACLLLLLSLD     71 - 140
AQTGECSSMPLQWNRGRNHLVLRLHPAPCPRTFQLGQAMVAEASPTVDSFRPGFDVALPFLPEAHPLRGG    141 - 210
APGQLRQHSPQPGVALLALEEERGGWRTADTGSSACPWDGRCEQDPGPGQTQRQETLPNATFCLISGHRP    211 - 280
EAASRFLQALQAGCIPVLLSPRWELPFSEVIDWTKAAIVADERLPLQVLAALQEMSPARVLALRQQTQFL    281 - 350
WDAYFSSVEKVIHTTLEVIQDRIFGTSAHPSLLWNSPPGALLALSTFSTSPQDFPFYYLQQGSRPEGRFS    351 - 420
ALIWVGPPGQPPLKLIQAVAGSQHCAQILVLWSNERPLPSRWPETAVPLTVIDGHRKVSDRFYPYSTIRT    421 - 490
DAILSLDARSSLSTSEVDFAFLVWQSFPERMVGFLTSSHFWDEAHGGWGYTAERTNEFSMVLTTAAFYHR    491 - 560
YYHTLFTHSLPKALRTLADEAPTCVDVLMNFIVAAVTKLPPIKVPYGKQRQEAAPLAPGGPGPRPKPPAP    561 - 630
APDCINQIAAAFGHMPLLSSRLRLDPVLFKDPVSVQRKKYRSLEKP                            631 - 676
//

Text Mined References (11)

PMID Year Title