Property Summary

NCBI Gene PubMed Count 11
PubMed Score 19.84
PubTator Score 9.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 1.82936538989693E-35
posterior fossa group A ependymoma 1511 2.52957323660377E-9
atypical teratoid / rhabdoid tumor 4369 1.57189119858897E-8
medulloblastoma 1524 1.11033603088287E-7
glioblastoma 5572 6.89313542792352E-6
pediatric high grade glioma 2712 8.0557793208075E-6
non-inflammatory breast cancer 208 1.01173687056652E-4
primitive neuroectodermal tumor 3031 1.41952941442829E-4
medulloblastoma, large-cell 6234 0.00135740181320635

Expression

  Differential Expression (9)

Synonym

Accession Q92935 Q6GSC1
Symbols EXTL

Gene

PANTHER Protein Class (2)

  Ortholog (6)

AA Sequence

MQSWRRRKSLWLALSASWLLLVLLGGFSLLRLALPPRPRPGASQGWPRWLDAELLQSFSQPGELPEDAVS      1 - 70
PPQAPHGGSCNWESCFDTSKCRGDGLKVFVYPAVGTISETHRRILASIEGSRFYTFSPAGACLLLLLSLD     71 - 140
AQTGECSSMPLQWNRGRNHLVLRLHPAPCPRTFQLGQAMVAEASPTVDSFRPGFDVALPFLPEAHPLRGG    141 - 210
APGQLRQHSPQPGVALLALEEERGGWRTADTGSSACPWDGRCEQDPGPGQTQRQETLPNATFCLISGHRP    211 - 280
EAASRFLQALQAGCIPVLLSPRWELPFSEVIDWTKAAIVADERLPLQVLAALQEMSPARVLALRQQTQFL    281 - 350
WDAYFSSVEKVIHTTLEVIQDRIFGTSAHPSLLWNSPPGALLALSTFSTSPQDFPFYYLQQGSRPEGRFS    351 - 420
ALIWVGPPGQPPLKLIQAVAGSQHCAQILVLWSNERPLPSRWPETAVPLTVIDGHRKVSDRFYPYSTIRT    421 - 490
DAILSLDARSSLSTSEVDFAFLVWQSFPERMVGFLTSSHFWDEAHGGWGYTAERTNEFSMVLTTAAFYHR    491 - 560
YYHTLFTHSLPKALRTLADEAPTCVDVLMNFIVAAVTKLPPIKVPYGKQRQEAAPLAPGGPGPRPKPPAP    561 - 630
APDCINQIAAAFGHMPLLSSRLRLDPVLFKDPVSVQRKKYRSLEKP                            631 - 676
//

Text Mined References (11)

PMID Year Title
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15110891 2004 Molecular analysis of the putative tumour-suppressor gene EXTL1 in neuroblastoma patients and cell lines.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12417417 2002 Hereditary multiple exostoses and heparan sulfate polymerization.
11390981 2001 Human tumor suppressor EXT gene family members EXTL1 and EXTL3 encode alpha 1,4- N-acetylglucosaminyltransferases that likely are involved in heparan sulfate/ heparin biosynthesis.
10575224 1999 Refined physical mapping and genomic structure of the EXTL1 gene.
10480354 Mutation analysis of hereditary multiple exostoses in the Chinese.
More...