Property Summary

Ligand Count 24
NCBI Gene PubMed Count 221
PubMed Score 103.41
PubTator Score 2910.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma -1.300 1.3e-03
atypical teratoid / rhabdoid tumor -1.200 2.2e-04
group 4 medulloblastoma -1.100 1.2e-03
medulloblastoma, large-cell -2.000 2.8e-05
ovarian cancer 1.400 1.9e-05
psoriasis 1.400 1.5e-04

Gene RIF (156)

AA Sequence

MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVEIR      1 - 70
SRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQ     71 - 140
MRQSSSWTRVFQSWWDRNLGRGSSAPSQ                                              141 - 168
//

Text Mined References (231)

PMID Year Title