Property Summary

NCBI Gene PubMed Count 206
Grant Count 7
Funding $634,488.67
PubMed Score 96.26
PubTator Score 2910.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis 1.400 0.000
atypical teratoid / rhabdoid tumor -1.200 0.000
medulloblastoma -1.100 0.001
medulloblastoma, large-cell -2.000 0.000
adult high grade glioma -1.300 0.001
ovarian cancer 1.400 0.000

 GWAS Trait (1)

Gene RIF (144)

PMID Text
26976600 Bcl-xL binds to dual BH3-like domains in the InsP3 receptor carboxyl terminus and regulates control of cell viability.
26722503 we can conclude that patients with small cell lung carcinoma represent downregulation of Bad and the latter could be served as a useful biomarker for the outcomes of SCLC.
26721202 Valproic acid sensitized TRAIL-resistant papillary thyroid carcinoma cells to apoptotic cell death through involvement of Nrf2 and Bcl-xL.
26668309 A Novel Naphthalimide Compound Restores p53 Function in Non-small Cell Lung Cancer by Reorganizing the Bak.Bcl-xl Complex and Triggering Transcriptional Regulation.
26590798 This studypredict response ketogenic dietary therapies. showed that Common variants in KCNJ11 and BAD do not responase to ketogenic diet therapy.
26581978 These data suggest that miR-BART20-5p plays an important role in latency maintenance and tumor persistence of Epstein-Barr virus-associated gastric carcinoma by inhibiting BAD-mediated caspase-3-dependent apoptosis.
26506422 Bcl-xL is responsible for TRAIL resistance in human pancreatic cancer cells. Bcl-2 family inhibitors could represent promising reagents to sensitize human pancreatic cancers to TRAIL.
26063499 LA provoked a down regulation of two anti-apoptotic proteins, Mcl-1 and Bcl-xL protein and a strong induction of the BH3-only protein Bim.
25907960 Bh3 domain induced conformational changes in Bcl-Xl revealed by crystal structure and comparative analysis.
25872771 These data suggest that Bcl-XL binds to RyR channels via its BH4 domain, but also its BH3 domain, more specific Lys87, contributes to the interaction.
More...

AA Sequence

MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVEIR      1 - 70
SRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQ     71 - 140
MRQSSSWTRVFQSWWDRNLGRGSSAPSQ                                              141 - 168
//

Text Mined References (216)

PMID Year Title
26976600 2016 Biphasic regulation of InsP3 receptor gating by dual Ca2+ release channel BH3-like domains mediates Bcl-xL control of cell viability.
26722503 2015 The downregulation of Bcl-xL/Bcl-2-associated death promoter indicates worse outcomes in patients with small cell lung carcinoma.
26721202 2016 Downregulation of Nrf2 by the combination of TRAIL and Valproic acid induces apoptotic cell death of TRAIL-resistant papillary thyroid cancer cells via suppression of Bcl-xL.
26668309 2016 A Novel Naphthalimide Compound Restores p53 Function in Non-small Cell Lung Cancer by Reorganizing the Bak·Bcl-xl Complex and Triggering Transcriptional Regulation.
26590798 2015 Variants in KCNJ11 and BAD do not predict response to ketogenic dietary therapies for epilepsy.
26581978 2015 Epstein-Barr Virus MicroRNA miR-BART20-5p Suppresses Lytic Induction by Inhibiting BAD-Mediated caspase-3-Dependent Apoptosis.
26506422 2015 Bcl-xL inhibition by molecular-targeting drugs sensitizes human pancreatic cancer cells to TRAIL.
26063499 2015 Lipoic acid decreases Mcl-1, Bcl-xL and up regulates Bim on ovarian carcinoma cells leading to cell death.
25907960 2015 Bh3 induced conformational changes in Bcl-Xl revealed by crystal structure and comparative analysis.
25872771 2015 Ryanodine receptors are targeted by anti-apoptotic Bcl-XL involving its BH4 domain and Lys87 from its BH3 domain.
More...