Property Summary

NCBI Gene PubMed Count 42
PubMed Score 287.43
PubTator Score 51.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adult high grade glioma -1.600 9.3e-04
atypical teratoid / rhabdoid tumor -2.900 4.9e-05
ependymoma -1.300 6.6e-06
gastric carcinoma -1.200 7.8e-03
glioblastoma -1.300 2.5e-05
group 3 medulloblastoma -1.400 9.8e-03
interstitial cystitis -1.100 1.9e-04
intraductal papillary-mucinous neoplasm ... -1.700 6.1e-03
lung cancer -1.100 3.8e-03
lung carcinoma 2.800 1.6e-45
malignant mesothelioma 2.900 1.6e-06
medulloblastoma, large-cell -3.600 8.6e-05
nasopharyngeal carcinoma -1.200 6.9e-08
non-small cell lung cancer -1.719 1.6e-14
osteosarcoma -1.483 1.1e-03
ovarian cancer -1.300 1.7e-06
pancreatic cancer -2.100 3.0e-04
primary pancreatic ductal adenocarcinoma -1.899 9.7e-05
severe Alzheimer's disease -1.051 4.9e-02
tuberculosis 1.500 7.6e-04
urothelial carcinoma -2.400 1.2e-02

Gene RIF (18)

AA Sequence

MGPPLPLLLLLLLLLPPRVLPAAPSSVPRGRQLPGRLGCLLEEGLCGASEACVNDGVFGRCQKVPAMDFY      1 - 70
RYEVSPVALQRLRVALQKLSGTGFTWQDDYTQYVMDQELADLPKTYLRRPEASSPARPSKHSVGSERRYS     71 - 140
REGGAALANALRRHLPFLEALSQAPASDVLARTHTAQDRPPAEGDDRFSESILTYVAHTSALTYPPGSRT    141 - 210
QLREDLLPRTLGQLQPDELSPKVDSGVDRHHLMAALSAYAAQRPPAPPGEGSLEPQYLLRAPSRMPRPLL    211 - 280
APAAPQKWPSPLGDSEDPSSTGDGARIHTLLKDLQRQPAEVRGLSGLELDGMAELMAGLMQGVDHGVARG    281 - 350
SPGRAALGESGEQADGPKATLRGDSFPDDGVQDDDDRLYQEVHRLSATLGGLLQDHGSRLLPGALPFARP    351 - 420
LDMERKKSEHPESSLSSEEETAGVENVKSQTYSKDLLGQQPHSEPGAAAFGELQNQMPGPSKEEQSLPAG    421 - 490
AQEALSDGLQLEVQPSEEEARGYIVTDRDPLRPEEGRRLVEDVARLLQVPSSAFADVEVLGPAVTFKVSA    491 - 560
NVQNVTTEDVEKATVDNKDKLEETSGLKILQTGVGSKSKLKFLPPQAEQEDSTKFIALTLVSLACILGVL    561 - 630
LASGLIYCLRHSSQHRLKEKLSGLGGDPGADATAAYQELCRQRMATRPPDRPEGPHTSRISSVSSQFSDG    631 - 700
PIPSPSARSSASSWSEEPVQSNMDISTGHMILSYMEDHLKNKNRLEKEWEALCAYQAEPNSSFVAQREEN    701 - 770
VPKNRSLAVLTYDHSRVLLKAENSHSHSDYINASPIMDHDPRNPAYIATQGPLPATVADFWQMVWESGCV    771 - 840
VIVMLTPLAENGVRQCYHYWPDEGSNLYHIYEVNLVSEHIWCEDFLVRSFYLKNLQTNETRTVTQFHFLS    841 - 910
WYDRGVPSSSRSLLDFRRKVNKCYRGRSCPIIVHCSDGAGRSGTYVLIDMVLNKMAKGAKEIDIAATLEH    911 - 980
LRDQRPGMVQTKEQFEFALTAVAEEVNAILKALPQ                                       981 - 1015
//

Text Mined References (48)

PMID Year Title