Property Summary

NCBI Gene PubMed Count 21
Grant Count 11
R01 Count 3
Funding $462,856.25
PubMed Score 5.83
PubTator Score 2.41

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
26471730 Rab8A GTPase Ser(111) phosphorylation is not directly regulated by PINK1 in vitro and demonstrate in cells the time course of Ser(111) phosphorylation of Rab8A, 8B and 13 is markedly delayed compared to phosphorylation of Parkin at Ser(65).
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAKTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERF      1 - 70
RTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSKERGEKLA     71 - 140
IDYGIKFLETSAKSSANVEEAFFTLARDIMTKLNRKMNDSNSAGAGGPVKITENRSKKTSFFRCSLL       141 - 207
//

Text Mined References (25)

PMID Year Title
26471730 2015 Phosphoproteomic screening identifies Rab GTPases as novel downstream targets of PINK1.
24564958 2014 Variability in the common genetic architecture of social-communication spectrum phenotypes during childhood and adolescence.
21269460 2011 Initial characterization of the human central proteome.
21255211 2011 Rab GTPases regulating phagosome maturation are differentially recruited to mycobacterial phagosomes.
20937701 2010 Family-wide characterization of the DENN domain Rab GDP-GTP exchange factors.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19717423 2009 The GTPase Rab3b/3c-positive recycling vesicles are involved in cross-presentation in dendritic cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
More...