Property Summary

NCBI Gene PubMed Count 21
PubMed Score 6.86
PubTator Score 2.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
active Crohn's disease 1.338 1.7e-02
active ulcerative colitis 1.241 1.2e-02
acute myeloid leukemia 1.200 4.2e-02
acute quadriplegic myopathy 1.023 2.4e-06
aldosterone-producing adenoma -1.148 2.2e-02
Astrocytoma, Pilocytic 1.600 7.4e-04
atypical teratoid / rhabdoid tumor 2.200 5.3e-07
autosomal dominant Emery-Dreifuss muscul... 1.118 5.0e-04
cutaneous lupus erythematosus 1.800 6.3e-04
Duchenne muscular dystrophy 1.097 2.2e-07
ependymoma 1.200 1.3e-03
gastric carcinoma 1.200 1.5e-02
glioblastoma 1.800 2.0e-07
group 4 medulloblastoma 1.100 1.2e-03
juvenile dermatomyositis 1.536 2.4e-12
lung adenocarcinoma -1.900 2.2e-15
lung cancer -2.000 1.3e-05
malignant mesothelioma -2.900 1.8e-07
medulloblastoma, large-cell -1.100 2.0e-03
non-small cell lung cancer -1.261 6.1e-19
osteosarcoma 2.568 2.3e-04
ovarian cancer -1.700 1.2e-15
pancreatic cancer 1.700 1.7e-03
pediatric high grade glioma 1.300 1.1e-05
Pick disease -1.200 1.4e-03
primary pancreatic ductal adenocarcinoma 1.778 1.3e-03
primary Sjogren syndrome 1.400 4.1e-04
primitive neuroectodermal tumor 1.200 8.6e-04
tuberculosis -1.600 1.1e-05

 GWAS Trait (1)

Gene RIF (2)

AA Sequence

MAKTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERF      1 - 70
RTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSKERGEKLA     71 - 140
IDYGIKFLETSAKSSANVEEAFFTLARDIMTKLNRKMNDSNSAGAGGPVKITENRSKKTSFFRCSLL       141 - 207
//

Text Mined References (25)

PMID Year Title