Property Summary

NCBI Gene PubMed Count 2
Grant Count 5
R01 Count 4
Funding $462,577.76
PubMed Score 36.31

Knowledge Summary

Patent

No data available

TINX Plot

 GO Function (1)

AA Sequence

MNPGYDCLFKLLLIGDSGVGKSCLLLRFADDPYTESYISTIGVDFKIQTIELDGKTIKLQIWDTAGQERF      1 - 70
WTITSSYYRGAHGFLVVYDVTDQESYANVKQWLQEIDRHASENVNKLLVGNKSDLTTKKVVDNTTAKEFA     71 - 140
DSLGIPFLETSAKNATNVEQAFMTMAAEIKKQMGPGAASGGERPNLKIDSTPVKPAGGGCC             141 - 201
//

Text Mined References (5)

PMID Year Title
22158903 2011 Legionella pneumophila regulates the small GTPase Rab1 activity by reversible phosphorylcholination.
21822290 2011 Modulation of Rab GTPase function by a protein phosphocholine transferase.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
15164053 2004 DNA sequence and analysis of human chromosome 9.
9030196 1997 RAB GTPases expressed in human melanoma cells.