Property Summary

NCBI Gene PubMed Count 2
PubMed Score 37.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

AA Sequence

MNPGYDCLFKLLLIGDSGVGKSCLLLRFADDPYTESYISTIGVDFKIQTIELDGKTIKLQIWDTAGQERF      1 - 70
WTITSSYYRGAHGFLVVYDVTDQESYANVKQWLQEIDRHASENVNKLLVGNKSDLTTKKVVDNTTAKEFA     71 - 140
DSLGIPFLETSAKNATNVEQAFMTMAAEIKKQMGPGAASGGERPNLKIDSTPVKPAGGGCC             141 - 201
//

Text Mined References (5)

PMID Year Title