Property Summary

NCBI Gene PubMed Count 17
PubMed Score 9.88
PubTator Score 3.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Leukemia, Myeloid 18 0.0 0.0
Neutropenia 72 0.0 0.0
Specific granule deficiency 2 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 3.9e-10
psoriasis 6694 8.2e-05
ovarian cancer 8520 1.4e-04
Disease Target Count Z-score Confidence
triple-A syndrome 17 3.595 1.8

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -3.749 3.9e-10
ovarian cancer 1.200 1.4e-04
psoriasis -2.700 8.2e-05

Gene RIF (4)

AA Sequence

MSGRGAGGFPLPPLSPGGGAVAAALGAPPPPAGPGMLPGPALRGPGPAGGVGGPGAAAFRPMGPAGPAAQ      1 - 70
YQRPGMSPGNRMPMAGLQVGPPAGSPFGAAAPLRPGMPPTMMDPFRKRLLVPQAQPPMPAQRRGLKRRKM     71 - 140
ADKVLPQRIRELVPESQAYMDLLAFERKLDQTIARKRMEIQEAIKKPLTQKRKLRIYISNTFSPSKAEGD    141 - 210
SAGTAGTPGGTPAGDKVASWELRVEGKLLDDPSKQKRKFSSFFKSLVIELDKELYGPDNHLVEWHRMPTT    211 - 280
QETDGFQVKRPGDLNVKCTLLLMLDHQPPQYKLDPRLARLLGVHTQTRAAIMQALWLYIKHNQLQDGHER    281 - 350
EYINCNRYFRQIFSCGRLRFSEIPMKLAGLLQHPDPIVINHVISVDPNDQKKTACYDIDVEVDDPLKAQM    351 - 420
SNFLASTTNQQEIASLDVKIHETIESINQLKTQRDFMLSFSTDPQDFIQEWLRSQRRDLKIITDVIGNPE    421 - 490
EERRAAFYHQPWAQEAVGRHIFAKVQQRRQELEQVLGIRLT                                 491 - 531
//

Text Mined References (33)

PMID Year Title