Property Summary

NCBI Gene PubMed Count 49
Grant Count 46
R01 Count 22
Funding $6,943,256.93
PubMed Score 63.09
PubTator Score 30.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Rheumatoid Arthritis 2.700 0.000
oligodendroglioma 1.200 0.031
osteosarcoma 1.785 0.000
glioblastoma 2.100 0.000
sonic hedgehog group medulloblastoma 2.400 0.000
astrocytoma 1.300 0.024
atypical teratoid / rhabdoid tumor 2.300 0.000
medulloblastoma, large-cell 3.200 0.000
primitive neuroectodermal tumor 2.000 0.000
lung cancer 2.600 0.000
colon cancer 1.100 0.001
diabetes mellitus -1.200 0.009
pediatric high grade glioma 1.600 0.000
lung adenocarcinoma 1.433 0.000
ovarian cancer 1.600 0.000

Gene RIF (14)

PMID Text
24434208 we identify BAF155 as a substrate for arginine methyltransferase CARM1.
24365151 Wwp2 acts as a ubiquitin ligase of SRG3.
23996527 Results show the secondary structure of SWIRM domain of BAF155 consists of five alpha-helices forming a typical histone fold for DNA interactions.
23799850 miR-320c regulates the resistance of pancreatic cancer cells to gemcitabine through SMARCC1.
22139574 loss of BAF155 expression represents another mechanism for inactivation of SWI/SNF complex activity in the development in human cancer.
21699904 HIV-1 Tat induces phosphorylation of BRG1 and BAF155
20829358 Data show that the mechanism of BAF155-mediated stabilization of BAF57 involves blocking its ubiquitination by preventing interaction with TRIP12.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19367581 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19156145 patients with tumours displaying high levels of CBFB and SMARCC1 proteins had a significantly better overall survival rate than patients with low levels
More...

AA Sequence

MAAAAGGGGPGTAVGATGSGIAAAAAGLAVYRRKDGGPATKFWESPETVSQLDSVRVWLGKHYKKYVHAD      1 - 70
APTNKTLAGLVVQLLQFQEDAFGKHVTNPAFTKLPAKCFMDFKAGGALCHILGAAYKYKNEQGWRRFDLQ     71 - 140
NPSRMDRNVEMFMNIEKTLVQNNCLTRPNIYLIPDIDLKLANKLKDIIKRHQGTFTDEKSKASHHIYPYS    141 - 210
SSQDDEEWLRPVMRKEKQVLVHWGFYPDSYDTWVHSNDVDAEIEDPPIPEKPWKVHVKWILDTDIFNEWM    211 - 280
NEEDYEVDENRKPVSFRQRISTKNEEPVRSPERRDRKASANARKRKHSPSPPPPTPTESRKKSGKKGQAS    281 - 350
LYGKRRSQKEEDEQEDLTKDMEDPTPVPNIEEVVLPKNVNLKKDSENTPVKGGTVADLDEQDEETVTAGG    351 - 420
KEDEDPAKGDQSRSVDLGEDNVTEQTNHIIIPSYASWFDYNCIHVIERRALPEFFNGKNKSKTPEIYLAY    421 - 490
RNFMIDTYRLNPQEYLTSTACRRNLTGDVCAVMRVHAFLEQWGLVNYQVDPESRPMAMGPPPTPHFNVLA    491 - 560
DTPSGLVPLHLRSPQVPAAQQMLNFPEKNKEKPVDLQNFGLRTDIYSKKTLAKSKGASAGREWTEQETLL    561 - 630
LLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYLENSDASLGPLAYQPVPFSQSGNPVMSTVA    631 - 700
FLASVVDPRVASAAAKAALEEFSRVREEVPLELVEAHVKKVQEAARASGKVDPTYGLESSCIAGTGPDEP    701 - 770
EKLEGAEEEKMEADPDGQQPEKAENKVENETDEGDKAQDGENEKNSEKEQDSEVSEDTKSEEKETEENKE    771 - 840
LTDTCKERESDTGKKKVEHEISEGNVATAAAAALASAATKAKHLAAVEERKIKSLVALLVETQMKKLEIK    841 - 910
LRHFEELETIMDREKEALEQQRQQLLTERQNFHMEQLKYAELRARQQMEQQQHGQNPQQAHQHSGGPGLA    911 - 980
PLGAAGHPGMMPHQQPPPYPLMHHQMPPPHPPQPGQIPGPGSMMPGQHMPGRMIPTVAANIHPSGSGPTP    981 - 1050
PGMPPMPGNILGPRVPLTAPNGMYPPPPQQQPPPPPPADGVPPPPAPGPPASAAP                  1051 - 1105
//

Text Mined References (62)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24434208 2014 CARM1 methylates chromatin remodeling factor BAF155 to enhance tumor progression and metastasis.
24421395 2014 Residual complexes containing SMARCA2 (BRM) underlie the oncogenic drive of SMARCA4 (BRG1) mutation.
24365151 2014 Wwp2 targets SRG3, a scaffold protein of the SWI/SNF-like BAF complex, for ubiquitination and degradation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23996527 2013 1H, 15N, and 13C resonance assignments and secondary structure of the SWIRM domain of human BAF155, a chromatin remodeling complex component.
23799850 2013 miR-320c regulates gemcitabine-resistance in pancreatic cancer via SMARCC1.
More...