Property Summary

NCBI Gene PubMed Count 53
PubMed Score 65.95
PubTator Score 30.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytoma 1.300 2.4e-02
atypical teratoid / rhabdoid tumor 2.300 8.9e-09
colon cancer 1.100 1.4e-03
diabetes mellitus -1.200 9.0e-03
glioblastoma 1.300 9.2e-10
group 3 medulloblastoma 1.700 9.3e-03
lung adenocarcinoma 1.433 1.2e-05
lung cancer 1.900 7.5e-04
medulloblastoma, large-cell 3.200 1.2e-07
oligodendroglioma 1.200 3.1e-02
osteosarcoma 1.108 1.8e-04
ovarian cancer 1.500 1.9e-04
pediatric high grade glioma 1.600 1.3e-05
primitive neuroectodermal tumor 2.000 3.0e-05
Rheumatoid arthritis 2.700 5.5e-06

Gene RIF (17)

AA Sequence

MAAAAGGGGPGTAVGATGSGIAAAAAGLAVYRRKDGGPATKFWESPETVSQLDSVRVWLGKHYKKYVHAD      1 - 70
APTNKTLAGLVVQLLQFQEDAFGKHVTNPAFTKLPAKCFMDFKAGGALCHILGAAYKYKNEQGWRRFDLQ     71 - 140
NPSRMDRNVEMFMNIEKTLVQNNCLTRPNIYLIPDIDLKLANKLKDIIKRHQGTFTDEKSKASHHIYPYS    141 - 210
SSQDDEEWLRPVMRKEKQVLVHWGFYPDSYDTWVHSNDVDAEIEDPPIPEKPWKVHVKWILDTDIFNEWM    211 - 280
NEEDYEVDENRKPVSFRQRISTKNEEPVRSPERRDRKASANARKRKHSPSPPPPTPTESRKKSGKKGQAS    281 - 350
LYGKRRSQKEEDEQEDLTKDMEDPTPVPNIEEVVLPKNVNLKKDSENTPVKGGTVADLDEQDEETVTAGG    351 - 420
KEDEDPAKGDQSRSVDLGEDNVTEQTNHIIIPSYASWFDYNCIHVIERRALPEFFNGKNKSKTPEIYLAY    421 - 490
RNFMIDTYRLNPQEYLTSTACRRNLTGDVCAVMRVHAFLEQWGLVNYQVDPESRPMAMGPPPTPHFNVLA    491 - 560
DTPSGLVPLHLRSPQVPAAQQMLNFPEKNKEKPVDLQNFGLRTDIYSKKTLAKSKGASAGREWTEQETLL    561 - 630
LLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYLENSDASLGPLAYQPVPFSQSGNPVMSTVA    631 - 700
FLASVVDPRVASAAAKAALEEFSRVREEVPLELVEAHVKKVQEAARASGKVDPTYGLESSCIAGTGPDEP    701 - 770
EKLEGAEEEKMEADPDGQQPEKAENKVENETDEGDKAQDGENEKNSEKEQDSEVSEDTKSEEKETEENKE    771 - 840
LTDTCKERESDTGKKKVEHEISEGNVATAAAAALASAATKAKHLAAVEERKIKSLVALLVETQMKKLEIK    841 - 910
LRHFEELETIMDREKEALEQQRQQLLTERQNFHMEQLKYAELRARQQMEQQQHGQNPQQAHQHSGGPGLA    911 - 980
PLGAAGHPGMMPHQQPPPYPLMHHQMPPPHPPQPGQIPGPGSMMPGQHMPGRMIPTVAANIHPSGSGPTP    981 - 1050
PGMPPMPGNILGPRVPLTAPNGMYPPPPQQQPPPPPPADGVPPPPAPGPPASAAP                  1051 - 1105
//

Text Mined References (69)

PMID Year Title