Property Summary

Ligand Count 6
NCBI Gene PubMed Count 39
PubMed Score 32.28
PubTator Score 38.25

Knowledge Summary

Patent (4,503)

Expression

  Differential Expression (5)

Disease log2 FC p
cutaneous lupus erythematosus 1.500 8.2e-03
interstitial cystitis 1.900 4.8e-04
intraductal papillary-mucinous neoplasm ... -1.200 2.4e-02
osteosarcoma -2.549 1.0e-06
primary Sjogren syndrome 1.200 6.1e-03

Gene RIF (18)

AA Sequence

MDVVDPDIFNRDPRDHYDLLQRLGGGTYGEVFKARDKVSGDLVALKMVKMEPDDDVSTLQKEILILKTCR      1 - 70
HANIVAYHGSYLWLQKLWICMEFCGAGSLQDIYQVTGSLSELQISYVCREVLQGLAYLHSQKKIHRDIKG     71 - 140
ANILINDAGEVRLADFGISAQIGATLARRLSFIGTPYWMAPEVAAVALKGGYNELCDIWSLGITAIELAE    141 - 210
LQPPLFDVHPLRVLFLMTKSGYQPPRLKEKGKWSAAFHNFIKVTLTKSPKKRPSATKMLSHQLVSQPGLN    211 - 280
RGLILDLLDKLKNPGKGPSIGDIEDEEPELPPAIPRRIRSTHRSSSLGIPDADCCRRHMEFRKLRGMETR    281 - 350
PPANTARLQPPRDLRSSSPRKQLSESSDDDYDDVDIPTPAEDTPPPLPPKPKFRSPSDEGPGSMGDDGQL    351 - 420
SPGVLVRCASGPPPNSPRPGPPPSTSSPHLTAHSEPSLWNPPSRELDKPPLLPPKKEKMKRKGCALLVKL    421 - 490
FNGCPLRIHSTAAWTHPSTKDQHLLLGAEEGIFILNRNDQEATLEMLFPSRTTWVYSINNVLMSLSGKTP    491 - 560
HLYSHSILGLLERKETRAGNPIAHISPHRLLARKNMVSTKIQDTKGCRACCVAEGASSGGPFLCGALETS    561 - 630
VVLLQWYQPMNKFLLVRQVLFPLPTPLSVFALLTGPGSELPAVCIGVSPGRPGKSVLFHTVRFGALSCWL    631 - 700
GEMSTEHRGPVQVTQVEEDMVMVLMDGSVKLVTPEGSPVRGLRTPEIPMTEAVEAVAMVGGQLQAFWKHG    701 - 770
VQVWALGSDQLLQELRDPTLTFRLLGSPRLECSGTISPHCNLLLPGSSNSPASASRVAGITGL           771 - 833
//

Text Mined References (44)

PMID Year Title